SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303455|ref|YP_001190771.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303455|ref|YP_001190771.1|
Domain Number 1 Region: 3-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.88e-29
Family GHMP Kinase, N-terminal domain 0.0000718
Further Details:      
 
Domain Number 2 Region: 167-284
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.77e-23
Family Homoserine kinase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303455|ref|YP_001190771.1|
Sequence length 311
Comment homoserine kinase [Metallosphaera sedula DSM 5348]
Sequence
MRSVKATAFSSSANLGAGYDVLSMSHLAFSDTVYAELINEKERRVMMESNSNVPLDPARN
SAGAPVEALLKEFQLNYTIKLNVIKGVPHGLGLGSSGASAVAAVAAVNELLNLHLTLEDI
VKFAVIGEQAVSGSPHPDNVAASAFGGIVAVTSHDPIRVVRIPINLNFRLMLVIPRVNTG
EGKTKKARELVPKQIEVSKMVENTRFLSSFILGLVKGDRALVREGLNDAVVERSREPMYP
HYPKLKEIALRYDAIGACVSGAGPTVLILYDDSTKLGEIKQEGGKVCAQHGFQCDFITTE
IGEGVRVEGLN
Download sequence
Identical sequences A0A088E309 A4YEJ5
WP_012020634.1.15515 WP_012020634.1.27320 WP_012020634.1.28583 WP_012020634.1.31166 WP_012020634.1.34633 WP_012020634.1.8883 WP_012020634.1.99084 gi|146303455|ref|YP_001190771.1| 399549.Msed_0672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]