SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303692|ref|YP_001191008.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303692|ref|YP_001191008.1|
Domain Number 1 Region: 14-91
Classification Level Classification E-value
Superfamily E set domains 4.2e-23
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146303692|ref|YP_001191008.1|
Sequence length 91
Comment glycoside hydrolase family protein [Metallosphaera sedula DSM 5348]
Sequence
MHFMLKTKDRPLRPGEPFPLGANWIEDEDGVNFSILSENAEKIELVLYLSDQRYPKEVME
VRNRTADIWHTFLGIRSSQLYGYRVHGPYKP
Download sequence
Identical sequences A0A088E6W5 A4YF82
399549.Msed_0912 gi|146303692|ref|YP_001191008.1| WP_012020871.1.15515 WP_012020871.1.27320 WP_012020871.1.28583 WP_012020871.1.31166 WP_012020871.1.34633 WP_012020871.1.8883 WP_012020871.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]