SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303827|ref|YP_001191143.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303827|ref|YP_001191143.1|
Domain Number 1 Region: 156-411
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.66e-66
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 6-154
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 6.55e-53
Family Malic enzyme N-domain 0.00000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303827|ref|YP_001191143.1|
Sequence length 422
Comment malate dehydrogenase [Metallosphaera sedula DSM 5348]
Sequence
MKPVEISLKYQGKIEVMPKVPISSYDDFSVIYTPGVAEVVKEISKDKDKSFQLTSRWNNV
AIITDGTRVLGLGNVGPEASLPVMEGKALLFKYLGGVDAIPLPLAVRDPDTIINVVSALE
PSFGGINLEDVESPKCFYILEKLQERMNIPVWHDDQQGTAGAVLAALINAMKVAGKGLDS
KIVIFGAGAANIATVRLLKAYGFDPKRMIVVDREGVLHAERRDLDAMMFSHKWKYEIAVT
TNGFNITTLDEAFKGADILIAASMPGPNTIPKRWISLMKDPIVFALANPVPEIYPSDAID
AGAKVVATGRSDFPNQVNNSLIFPGVFRGVLDSRSSKVDDAMVIAGAEALARFAERKGIS
PTYIIPRMDEWDAYYELASAVAEKAVERGYARVRLSREEFRLMAKTKIEQTRNKIRAIQN
VD
Download sequence
Identical sequences A0A088E7A5 A4YFL7
gi|146303827|ref|YP_001191143.1| 399549.Msed_1054 WP_012021006.1.15515 WP_012021006.1.27320 WP_012021006.1.28583 WP_012021006.1.31166 WP_012021006.1.34633 WP_012021006.1.8883 WP_012021006.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]