SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303865|ref|YP_001191181.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303865|ref|YP_001191181.1|
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000114
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303865|ref|YP_001191181.1|
Sequence length 137
Comment hypothetical protein Msed_1093 [Metallosphaera sedula DSM 5348]
Sequence
MPEPLELSRYLDRLRAFKWRDFDVYYAILFGSLAKRGRGNDIDIAVEFKRKSLDAYSSLL
ASLRNYLDEDRVDLVMISDNSDCFLVHEVFSDSLILYMEDYDRMHRIASICEDFLIDLKK
LQILENAGRAIMRRWQS
Download sequence
Identical sequences A0A088E5H6 A4YFQ5
WP_012021044.1.15515 WP_012021044.1.27320 WP_012021044.1.28583 WP_012021044.1.31166 WP_012021044.1.34633 WP_012021044.1.8883 WP_012021044.1.99084 gi|146303865|ref|YP_001191181.1| 399549.Msed_1093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]