SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303895|ref|YP_001191211.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303895|ref|YP_001191211.1|
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.21e-59
Family D-glucarate dehydratase-like 0.00042
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.53e-19
Family Enolase N-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303895|ref|YP_001191211.1|
Sequence length 380
Comment mandelate racemase/muconate lactonizing protein [Metallosphaera sedula DSM 5348]
Sequence
MNIQIFPLSIPFFTDPVSEFSDQWSVQLYVKASWDDVSGWGETGVFGSGILGAYVSILKE
LIVPLLSRYPITLPYDVETFLEKVMLTAGNCGVVTGAISSVEMAMWDARARKLNTSLAEM
LGGRVRERVPVYGSFPRFKSSEDVVSTVVKTTERGYKMIKLHQPPSSVVEDLHEIREKIG
YDVKVALDMNAPFDLESAKKFVDAVAKYEVEWVEEPIWPLDDYDSLRKLCDYSPVPIAAG
ENEYTIHGFRRLLETGIAYLQPDIAKIGGVSKFLKVLDLASGYNVKVAPHDRPDSSPLSL
MYVLQIASARSEISIIEFTISDFPSGLFENIPRFRHGTLEVPAGQGIGLKVKEDQLEKYS
YEEKLRILAFSDLEAKLRDK
Download sequence
Identical sequences A0A088E5J5 A4YFT5
WP_012021074.1.15515 WP_012021074.1.27320 WP_012021074.1.28583 WP_012021074.1.31166 WP_012021074.1.34633 WP_012021074.1.8883 WP_012021074.1.99084 gi|146303895|ref|YP_001191211.1| 399549.Msed_1125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]