SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303987|ref|YP_001191303.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303987|ref|YP_001191303.1|
Domain Number 1 Region: 10-247
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.09e-46
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00033
Further Details:      
 
Domain Number 2 Region: 236-389
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.26e-34
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303987|ref|YP_001191303.1|
Sequence length 393
Comment acyl-CoA dehydrogenase domain-containing protein [Metallosphaera sedula DSM 5348]
Sequence
MNEITSLLNVGEDVSLLLESLREMMAKYPEKYWGDLDLKEEFPSSFLHDFMSLGFGNVLF
PREFGGGGLGVLDASLLLREINLLGGNAYFVHGQYYNAVLLNRCAQESLKRRYYPEIVEN
NLKVLSLALTEPEVGSDTTKIKTTAQKEGNRFLINGHKIFISRVDKTDFLIVVARTEPYS
RERKSHGITMFLVDMRDLRGRIEMRRIRTMANTDAYELFIENLEVPDTNVIGEVDQGFQC
LLSCLNAERIMIASEMIGNAEYFLERGTEYARTREVFDRPIGQNQGVQFPLAQGFADLVT
SALALKYAGELYDSNADNRVVGTYANIAKYKASETAWFLGNVVMDVFGGLGYARDTGIER
KLRETRLFLVAPVSRNLILADLAHNALKLPRSF
Download sequence
Identical sequences A0A088E4J0 A4YG27
399549.Msed_1218 gi|146303987|ref|YP_001191303.1| WP_012021166.1.15515 WP_012021166.1.27320 WP_012021166.1.28583 WP_012021166.1.31166 WP_012021166.1.34633 WP_012021166.1.8883 WP_012021166.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]