SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304087|ref|YP_001191403.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304087|ref|YP_001191403.1|
Domain Number 1 Region: 3-274
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 6.41e-77
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.000000775
Further Details:      
 
Domain Number 2 Region: 265-478
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.61e-64
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304087|ref|YP_001191403.1|
Sequence length 507
Comment vinylacetyl-CoA Delta-isomerase [Metallosphaera sedula DSM 5348]
Sequence
MVVRTGEQYLQSISNRSKVEIYVMGREVKDVTKHPFLKPSVMSFKATFDAAWEEDTKELG
RAWSPYLEEEINRFNHIHRSPDDLAAKVKLLRKLSHKTGACFQRCVGWDSLNTLHIVTTM
MAKKGKTEVRDRFVEYLKYVQKNDLALAGAMTDAKGIRNLKPSQQPNKNAYLRITEVTKD
GIYVSGAKANITGVAATEEMVVLPTRAMGPEDKDYAVAFAIPTDTEGVKIVVGRQLNDAR
RMEEGEIDGLPYFYNHEGLVIFDNVFVPMNRVFLAGEWEYTGTLVEIFSAYHRQGYGGCK
AGLGDVIIGASADLAKQIGVDRASHVQDKLTEMIFLTETMYSAGIAASLNAVKMCDNCWW
VNPMHANVTKHLVARFPSQIAQLSIDLAGGIVGTAPSEWDLKNPKLKEYISRYLQGAEDF
TAEDRLRMVRLVENVSMGVAFQIESVHGAGSPAAQRIMFSRLYDLNFAQEVAKKLAGRKS
EVKFTSKAEPWRESQSEAEAKEAGLKS
Download sequence
Identical sequences A0A088E4U9 A4YGC7
399549.Msed_1321 WP_012021266.1.15515 WP_012021266.1.27320 WP_012021266.1.28583 WP_012021266.1.31166 WP_012021266.1.34633 WP_012021266.1.8883 WP_012021266.1.99084 gi|146304087|ref|YP_001191403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]