SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304120|ref|YP_001191436.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304120|ref|YP_001191436.1|
Domain Number 1 Region: 35-164,260-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-40
Family Tandem AAA-ATPase domain 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|146304120|ref|YP_001191436.1|
Domain Number - Region: 375-454
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0942
Family Nuclease 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304120|ref|YP_001191436.1|
Sequence length 660
Comment type III restriction enzyme, res subunit [Metallosphaera sedula DSM 5348]
Sequence
MSISETFVEKLRDSLGFAPYPYQEKVVQDVLDNLRKSRFIVVSMPTGSGKTLVELALADY
LRGKGMKVLVLEPTRLLCDQMYHNFWVKVFDDVGEEYEGNCTSFEEGKGVIVSTPFTSSK
CMPKVDAVIVDEVHHAFGDPRYMSGLISMKPRIVIGFTALLPSSKRYSMDSRFVEAFGVP
SLLAYDFKKLSEIDPSFTLPKAIADVFDAEMDGVENVAYDALLKGKIPGDERTLSFLRFT
LYSHGKTAFCESLENVRDKVSDNVTLRTLCSSEGMGHKARSLKEILEAYDVEEHRPVLIF
TARRSTAHEFEVILHNMGVNRVKTLTGELNKEERLQIVNEAKSGNVDVIISTHVGEEGID
IPEARLLIMTDVPKSPLRFYQRLGRLIRKSESKGVKYLVVTLTPKTPEYDDLDEALRSLH
REGVDVSYIVERKSGKGSTSRILDQVKEKGGEVPLMKLLEMEYDLKDYIMVRGKSNVTQF
LNAKEQDIPYSDFVDRAIMDGDLMYYYDVEGMGDLFAKILLSKYCQLCYGSQCQGLCDLD
IMVLGRSKQYKLTRKDLLRYFMVLFPPDKLTDVEKRMEITFENPGFGISLQSNVNEKNSS
ISFNVQLNASINGITVYPKITLAYYGVKKEVKDFLKKNVLAICNTAGKIYFSYFTSRPVP
Download sequence
Identical sequences A0A088E583 A4YGG0
gi|146304120|ref|YP_001191436.1| WP_012021299.1.15515 WP_012021299.1.27320 WP_012021299.1.28583 WP_012021299.1.31166 WP_012021299.1.34633 WP_012021299.1.8883 WP_012021299.1.99084 399549.Msed_1354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]