SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304149|ref|YP_001191465.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304149|ref|YP_001191465.1|
Domain Number 1 Region: 15-193
Classification Level Classification E-value
Superfamily vWA-like 3.53e-27
Family Integrin A (or I) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304149|ref|YP_001191465.1|
Sequence length 363
Comment von Willebrand factor A [Metallosphaera sedula DSM 5348]
Sequence
MFRIVLVPESKFEAKNLHYVILIDRSYSMKGEKLEMAKEGARLLVDNLPKDSRFSLLAFN
EKVSIIKEHEHPSEMGKELESLKVGSGTAMYKALQEAFNLARKYGEPTYVILLTDGVPSD
MGCMPGLSRKFDLNRCLPVYQGLSVPENVQIISFGIGDDYSEEILTEVSEKGRGFFYHVT
DPAQIPEKMPKLVKSEVAASDVTVDLVSESPVKLLNYDSLPVRINAVEGVVKIFGETVIP
KEYTGKFMTLKVKYRDEKGIRDRTQEFFLTRAQNQQDFISAIDRDVIMEYEYLQTLQNYS
RDLEARNLVEATKKLDRLREIAEQTRRQDLQEVAEELTRKMTSGEGNPKEIASEVTRKMR
GAE
Download sequence
Identical sequences A0A088E873 A4YGI9
gi|146304149|ref|YP_001191465.1| 399549.Msed_1383 WP_012021328.1.15515 WP_012021328.1.27320 WP_012021328.1.28583 WP_012021328.1.31166 WP_012021328.1.34633 WP_012021328.1.8883 WP_012021328.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]