SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304169|ref|YP_001191485.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304169|ref|YP_001191485.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily YjgF-like 4.08e-44
Family YjgF/L-PSP 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304169|ref|YP_001191485.1|
Sequence length 126
Comment endoribonuclease L-PSP [Metallosphaera sedula DSM 5348]
Sequence
MKEIIYSENSPKPIGPYSQAVLVDRILFVSGQIPLDPKTNELVKGGIEEQTKQVMENLKG
ILSSTGMTLDNVTMSFVYLKNLQDFPKFNEVYAKYFKEKPPARVTVQVGDLPRGSLVEIA
VIAYKF
Download sequence
Identical sequences A0A088E897 A4YGK9
399549.Msed_1403 WP_012021348.1.15515 WP_012021348.1.27320 WP_012021348.1.28583 WP_012021348.1.31166 WP_012021348.1.34633 WP_012021348.1.8883 WP_012021348.1.99084 gi|146304169|ref|YP_001191485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]