SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304257|ref|YP_001191573.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304257|ref|YP_001191573.1|
Domain Number 1 Region: 39-199
Classification Level Classification E-value
Superfamily vWA-like 7.99e-33
Family Integrin A (or I) domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304257|ref|YP_001191573.1|
Sequence length 383
Comment von Willebrand factor, type A [Metallosphaera sedula DSM 5348]
Sequence
MTLSMKVEVSHKYSFNSDLKMAFKILLVPEKISTATGFHYIVLLDTSGSMDGLKIESAKK
GAIELLKRIPQGNKVSFVTFSSRVNIVREFVDPEDLTAEISSLSAGGQTAFFTALLTAFN
LHNKHGIPSYVILLTDGNPTDDTNVETYKRIAIPNGVQTISFGLGDDYNETILKSLADRS
GGVFYHVNDAMEIPEKLPKAAKTKIAAKNVTVDIVAESNVKLLNYSGPPVQLNAVEGVVK
ILGEAVVPPNYSGNFMTVKANYEEPVDGRKQALLSVVNIKPADSQATFVSGVNKDVLLEY
EYFNNLQKISSEVQAGNLVEATRTLKRMEEIAGQTRKIELMETTRRLSDSLETTKRSGNA
TEQTRKLSKEVSSEVTRKLRGES
Download sequence
Identical sequences A0A088E6M9 A4YGU7
gi|146304257|ref|YP_001191573.1| WP_012021436.1.15515 WP_012021436.1.27320 WP_012021436.1.28583 WP_012021436.1.31166 WP_012021436.1.34633 WP_012021436.1.8883 WP_012021436.1.99084 399549.Msed_1492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]