SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304276|ref|YP_001191592.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304276|ref|YP_001191592.1|
Domain Number 1 Region: 49-189
Classification Level Classification E-value
Superfamily HAD-like 1.04e-24
Family HAD-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304276|ref|YP_001191592.1|
Sequence length 203
Comment HAD family hydrolase [Metallosphaera sedula DSM 5348]
Sequence
MSFEKLVVRLRKAGYPVTAKQVFRAVTKVMGKSNFPNQVGLNPVDVGELLYELGIYPSSQ
ILGQLGGDYTPSQDYFLYEDAKEFLEYLNSKGVDVVLITNATRRMHDVIDSLGIKKYVKA
VIASCDVGVVKPHPRIFRYALNYVAQPAIHIGDIYELDYIGAKRAGLESLLLDRFGFYED
VKVNKVRNLYEAMTYLDKQKLLV
Download sequence
Identical sequences A0A088E7H6 A4YGW6
399549.Msed_1511 WP_012021455.1.15515 WP_012021455.1.27320 WP_012021455.1.28583 WP_012021455.1.31166 WP_012021455.1.34633 WP_012021455.1.8883 WP_012021455.1.99084 gi|146304276|ref|YP_001191592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]