SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304280|ref|YP_001191596.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304280|ref|YP_001191596.1|
Domain Number 1 Region: 183-272
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000012
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 
Domain Number 2 Region: 56-132
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000366
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304280|ref|YP_001191596.1|
Sequence length 273
Comment hypothetical protein Msed_1515 [Metallosphaera sedula DSM 5348]
Sequence
MKLSRAFYDLVGASVLWGTIGIAVQEAYRFGANSLGIVLFRTLFSCLILFYQGNRKILLR
WESIAMGLIAGTFYEIYAFTIILDGAPLSSFLLYTAPLFVILFSYALFKEELNLRKVIGS
FIVIVALYLDYLGTPTPVELIWGILSGVSYAGLISFSKFLQLRRFSGWDVLSAQSVWSLP
LSLVVSLPFSRSISVGSVAGGLYMAILGTIIPYYLFYRGIKLMDSAIATVISALEPVVTT
LLAYPLLGQTLTPLQILSASMILGSSIWLSLSR
Download sequence
Identical sequences A0A088E5S0 A4YGX0
WP_012021459.1.15515 WP_012021459.1.27320 WP_012021459.1.28583 WP_012021459.1.31166 WP_012021459.1.34633 WP_012021459.1.8883 WP_012021459.1.99084 gi|146304280|ref|YP_001191596.1| 399549.Msed_1515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]