SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304283|ref|YP_001191599.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|146304283|ref|YP_001191599.1|
Domain Number - Region: 50-97
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0203
Family Type 2 phosphatidic acid phosphatase, PAP2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304283|ref|YP_001191599.1|
Sequence length 105
Comment hypothetical protein Msed_1519 [Metallosphaera sedula DSM 5348]
Sequence
MRNWGYWIHGVTMATIQIAPHVREMLNTHGFDRKVTLPIKMVSNMDAVINTALPKSVVGV
IAVLNPDTGSCDQVKNTVQRVRPNAYTMCLFDEGYPSNIISIYYK
Download sequence
Identical sequences A0A088E5E6 A4YGX3
399549.Msed_1519 WP_012021462.1.15515 WP_012021462.1.27320 WP_012021462.1.28583 WP_012021462.1.31166 WP_012021462.1.34633 WP_012021462.1.8883 WP_012021462.1.99084 gi|146304283|ref|YP_001191599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]