SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304295|ref|YP_001191611.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304295|ref|YP_001191611.1|
Domain Number 1 Region: 167-266
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000144
Family Multidrug resistance efflux transporter EmrE 0.02
Further Details:      
 
Weak hits

Sequence:  gi|146304295|ref|YP_001191611.1|
Domain Number - Region: 36-126
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00798
Family Multidrug resistance efflux transporter EmrE 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304295|ref|YP_001191611.1|
Sequence length 267
Comment hypothetical protein Msed_1531 [Metallosphaera sedula DSM 5348]
Sequence
MNKYYFILILGGITFGTAAIFIKLSGMSPGMIAFTRFFIAGLILSRGRLHLRRILSQWKV
GLLLSAHMILFIFSVYYTTIIDSTVLVSTSPLFSLALAPLVGIPTTKKEIITGAVAFMGV
ILMNFPVNQGYLLGNVMAIISALTIALYTILLSKTKNEDPLLLTSYIYLMSSVFSFPIAL
VEGPGRVDLVSILSLLGLIALPTLVGHTSVIYASGHVKPQHIEVIGLLEPVVATLLALPI
FNQVPTPLEIVGGGMIVLSVSILTWRR
Download sequence
Identical sequences A0A088E5T0 A4YGY5
gi|146304295|ref|YP_001191611.1| WP_012021474.1.15515 WP_012021474.1.27320 WP_012021474.1.28583 WP_012021474.1.31166 WP_012021474.1.34633 WP_012021474.1.8883 WP_012021474.1.99084 399549.Msed_1531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]