SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304333|ref|YP_001191649.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304333|ref|YP_001191649.1|
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily Single hybrid motif 2.09e-27
Family Biotinyl/lipoyl-carrier proteins and domains 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304333|ref|YP_001191649.1|
Sequence length 137
Comment glycine cleavage H-protein [Metallosphaera sedula DSM 5348]
Sequence
MQINGFSFPDDLLYDPEKHVWAKLEGNILTLGVTDLGQYMTGKIFQVSAKNVGDKINPRT
PVFTVESAKWIGKFRFPVHGEVIEVNRKVLDNASLLNDDPYGSWIVKIRVDEMDRNAFKP
LSEVKEIFEKEASRIAK
Download sequence
Identical sequences A0A088E5I1 A4YH23
gi|146304333|ref|YP_001191649.1| 399549.Msed_1570 WP_012021512.1.15515 WP_012021512.1.27320 WP_012021512.1.28583 WP_012021512.1.31166 WP_012021512.1.34633 WP_012021512.1.8883 WP_012021512.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]