SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304373|ref|YP_001191689.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304373|ref|YP_001191689.1|
Domain Number 1 Region: 131-348
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 4.45e-71
Family Creatinase/aminopeptidase 0.00000217
Further Details:      
 
Domain Number 2 Region: 11-123
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.000000331
Family Creatinase/prolidase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304373|ref|YP_001191689.1|
Sequence length 354
Comment peptidase M24 [Metallosphaera sedula DSM 5348]
Sequence
MRLNKLEKIKEKSNAKNLLIVGEPNLFYFTGYRGVGGLLDCDGTRTLLVPLLERNRALGI
KDLDVKVYYPVKLEENVIEGTLVSAVEKLCPSTTDKKLLIDLGYASVDLFLQLSSKYEAK
NITEDILQTRAIKEEKEIEAIRHAQRATAMAMKMASESLVEGISEIELAGIIDETMRKGG
AEDYAFPSIVAFGENSAEPHHIPCERRLRKGDTVVVDIGAKYNGYSFDSTRTFLYGITEK
SKRIYDVVLEAQLEAIDAVQEGIEASQIDRIARSRIEKEGFGKLFVHSTGHGVGIEVHES
PAISMKSKDILREGMVITVEPGIYFQGELGVRIEDTILVRKGKPEVLETLYKTL
Download sequence
Identical sequences A0A088E5K9 A4YH63
gi|146304373|ref|YP_001191689.1| WP_012021552.1.15515 WP_012021552.1.27320 WP_012021552.1.28583 WP_012021552.1.31166 WP_012021552.1.34633 WP_012021552.1.8883 WP_012021552.1.99084 399549.Msed_1610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]