SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304412|ref|YP_001191728.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304412|ref|YP_001191728.1|
Domain Number 1 Region: 5-125,240-395
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.09e-87
Family Substrate-binding domain of HMG-CoA reductase 0.00000354
Further Details:      
 
Domain Number 2 Region: 128-242
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 2.62e-45
Family NAD-binding domain of HMG-CoA reductase 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304412|ref|YP_001191728.1|
Sequence length 410
Comment 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Metallosphaera sedula DSM 5348]
Sequence
MDKIDEVVEKVVKGEIELHKVDEHLDGNAAVVARRMAIEKLTGKSFPSIGATIIDYLDVK
GRNAENVIGAAQVPLGVAGPIMVEGDYAKGSFFVPLATTEGALIASVNRGMKVLRHAGPV
RTKVLRDGMTRAPVFTFESALDAFKFTEWVKSNFQEIKRVAESTSSHARLIKIDPLQLGN
NVWLRFEYETGDAMGMNMVTVATEAACSYLEEKFPRARCVAVSGNACSDKKQSMTNELLG
RGKSVVAEALIPSRILETHLRTTADRIQEVNLRKNWLGGARAGTIFQFNAHFANIIAAIF
IATGQDVAQVVESSTGYTWVENRNGDLYISVTLPSLEVGTVGGGTRLPTQREALSMMGVD
GGGNPPGSNARKLAEIISAAVLAGELNLLSALSTRELGKAHLRLGRGMKT
Download sequence
Identical sequences A0A088E6Z0 A4YHA2
399549.Msed_1649 WP_012021591.1.15515 WP_012021591.1.27320 WP_012021591.1.28583 WP_012021591.1.31166 WP_012021591.1.34633 WP_012021591.1.8883 WP_012021591.1.99084 gi|146304412|ref|YP_001191728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]