SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304450|ref|YP_001191766.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304450|ref|YP_001191766.1|
Domain Number 1 Region: 9-418
Classification Level Classification E-value
Superfamily ADC synthase 2.88e-137
Family ADC synthase 0.0000000000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304450|ref|YP_001191766.1|
Sequence length 420
Comment anthranilate synthase component I [Metallosphaera sedula DSM 5348]
Sequence
MKTYPITAFAQPYEVYQCIERDQEIAALMESVEGSQNTARYSVIAWGVKRKVQVNRGDDL
EESILNALRGVEEGELRFSGGLLGYISYDAVRRWETVRDLKPAIEDWPDAEFFLPENVLV
FDHALGKVFVEGDIPSIAGCFEQGEFKVTPHDESMTKQEYESGVNSILEYIKSGYAFQVV
LSRFYRYAVQGDPMRLYRNLRKINPSPYMFYIKFGERKLIGSSPELLFSVQRGIAETFPI
AGTRPRGKTSEEDFELEQELLSSEKEMAEHLMLVDLARNDIGKSCVPGTVKVPEFAYVEK
YSHVQHIVSRVVGTLRKDANSLDVLKSMFPAGTVSGAPKPMAMNIIELLEPYKRGPYAGA
VGFISRNSAEFAITIRTAMINRDILRIQAGAGIVYDSVPEQEYYETEHKMRALKVALGVS
Download sequence
Identical sequences A0A088E670 A4YHE0
gi|146304450|ref|YP_001191766.1| 399549.Msed_1687 WP_012021629.1.15515 WP_012021629.1.27320 WP_012021629.1.28583 WP_012021629.1.31166 WP_012021629.1.34633 WP_012021629.1.8883 WP_012021629.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]