SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304499|ref|YP_001191815.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304499|ref|YP_001191815.1|
Domain Number 1 Region: 74-206
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.07e-19
Family Cytidylyltransferase 0.0076
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily AF1782-like 1.19e-19
Family AF1782-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304499|ref|YP_001191815.1|
Sequence length 216
Comment cytidyltransferase [Metallosphaera sedula DSM 5348]
Sequence
MPELRDRVIKYINGMEETLKQVKGDERIISLARQYVDDAKYYLERGDLETALVDVVYAEG
LVDALKIVEGEGSKKVFVGGTFDIIHPGHIEFLRRAASLGRVYVAVSRDKNAEKVKGRKP
VNDENQRLEVVKSIRYVYEAFLGDENDFLKSVERVKPDIIFLGPDQKVDEKALKEELARR
GILVEVVRLEHRINTWGHSSTSAIIKEITERYCNHA
Download sequence
Identical sequences A0A088E975 A4YHI9
gi|146304499|ref|YP_001191815.1| 399549.Msed_1736 WP_012021678.1.15515 WP_012021678.1.27320 WP_012021678.1.28583 WP_012021678.1.31166 WP_012021678.1.34633 WP_012021678.1.8883 WP_012021678.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]