SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304500|ref|YP_001191816.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304500|ref|YP_001191816.1|
Domain Number 1 Region: 86-215
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 7.85e-40
Family CTP-dependent riboflavin kinase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000709
Family MarR-like transcriptional regulators 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304500|ref|YP_001191816.1|
Sequence length 217
Comment hypothetical protein Msed_1737 [Metallosphaera sedula DSM 5348]
Sequence
MSDECLIAKIVYLSLQQKEVTQQMIADELKMSQQSVSRKLKELEERNLVRRSLSKEGEII
RVTENGEKLLEDCLSMMRATIISSHVLEIRGRATSGLGEGRIFLSMPYYMESFKKFLGFE
PYPGTLNLVIYDRISLENRLVLDISKAINIPEHKEENRVLGAVRAFPASVNDLKPAAVVF
PLRSVHPKSVIEVISPYHLRKELNIKDGDEVVIQAYA
Download sequence
Identical sequences A0A088E6B5 A4YHJ0
399549.Msed_1737 gi|146304500|ref|YP_001191816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]