SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304510|ref|YP_001191826.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304510|ref|YP_001191826.1|
Domain Number 1 Region: 10-96
Classification Level Classification E-value
Superfamily AlbA-like 3.53e-27
Family DNA-binding protein AlbA 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304510|ref|YP_001191826.1|
Sequence length 98
Comment DNA/RNA-binding protein albA [Metallosphaera sedula DSM 5348]
Sequence
MSGTSPTPSNVVLVGKKPVMNYVLAALTLLNQGVPEIIIKARGRAISKAVDTVEIVRNRF
LPDKIEIRAIGVGSQVVTSQDGRQSRVSTIEISIKKKA
Download sequence
Identical sequences A0A088E6C5 A4YHK0
399549.Msed_1747 gi|146304510|ref|YP_001191826.1| WP_012021689.1.15515 WP_012021689.1.27320 WP_012021689.1.28583 WP_012021689.1.31166 WP_012021689.1.34633 WP_012021689.1.8883 WP_012021689.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]