SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304548|ref|YP_001191864.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304548|ref|YP_001191864.1|
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily LigT-like 1.41e-40
Family 2'-5' RNA ligase LigT 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304548|ref|YP_001191864.1|
Sequence length 180
Comment 2'-5' RNA ligase [Metallosphaera sedula DSM 5348]
Sequence
MRLFIGIPVYDAPWLREALGMVERTGADVKLVEPQNVHITLAFLGEVAEDRVNLVRESLD
EVKFTAFRVVFRGLGAFPSVSRPRVVWMGITEGFNELKRIRTSLVKALNSRRVRVEEEQF
VPHLTLGRVKGPRGVLELAKLVEEMSDKQFGEQEVKEIVLFKSTLTPKGPIYDPLHRITA
Download sequence
Identical sequences A0A088E650 A4YHN8
gi|146304548|ref|YP_001191864.1| 399549.Msed_1785 WP_012021727.1.15515 WP_012021727.1.27320 WP_012021727.1.28583 WP_012021727.1.31166 WP_012021727.1.34633 WP_012021727.1.8883 WP_012021727.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]