SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304604|ref|YP_001191920.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304604|ref|YP_001191920.1|
Domain Number 1 Region: 32-264
Classification Level Classification E-value
Superfamily SIS domain 6.15e-31
Family double-SIS domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304604|ref|YP_001191920.1|
Sequence length 276
Comment bifunctional phosphoglucose/phosphomannose isomerase [Metallosphaera sedula DSM 5348]
Sequence
MDSLYEDWDRLYAEANKLQVPRVEGEVFCFGMGGSGVACEVMSAFYPLLRDMRHADVVIA
VSYSGNTRETLEIVRKATSAGKRIVAITSGGALATLPVERILVRGGDQPRYSFPLLFLPL
VKMLRPELTEEVIRGVNANEARRVAGDLLSAIRGRIPVFYASIYLGLAKRFKQEINENAK
YPAFFGEIPEVNHNEIEGYAHGSGLFPVVFSSGPLDEVTASLVNAKVIRISGIRDVSLLI
QSAGFLSVMLARELGEDPEKLTRIPEGRKLVERIGS
Download sequence
Identical sequences A0A088E9H7 A4YHU4
gi|146304604|ref|YP_001191920.1| 399549.Msed_1856 WP_012021783.1.15515 WP_012021783.1.27320 WP_012021783.1.28583 WP_012021783.1.31166 WP_012021783.1.34633 WP_012021783.1.8883 WP_012021783.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]