SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304620|ref|YP_001191936.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304620|ref|YP_001191936.1|
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000114
Family GHMP Kinase, N-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 211-252
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000321
Family Homoserine kinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304620|ref|YP_001191936.1|
Sequence length 266
Comment shikimate kinase [Metallosphaera sedula DSM 5348]
Sequence
MEEVHGGMQAYGGISVVNALPSWYGSAMAVDMKVNVRVREGKRNVQDLLLNEILNYFERQ
GIPELEVEVESEIPPGSGLKSSSAVSNALIGEIAERFSLNVDIPKLSAILSLKAGVSFTG
ALDDAVASWCGGVSFTYNKEFKVIKRERAPRDVTVVILERSGKGKIDLGKLRAFRALFQE
IFAIALQGRLWEAMKLNGIAIAEILGFPTDLVEEALRKGALASGLSGNGPSYFAVTREGD
EGPVIEAFEKRGKVRVTRVVDLVRGN
Download sequence
Identical sequences A0A088E6M5 A4YHW0
399549.Msed_1872 gi|146304620|ref|YP_001191936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]