SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304622|ref|YP_001191938.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304622|ref|YP_001191938.1|
Domain Number 1 Region: 20-113
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.78e-25
Family Shikimate dehydrogenase-like 0.00032
Further Details:      
 
Domain Number 2 Region: 130-260
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.53e-24
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304622|ref|YP_001191938.1|
Sequence length 272
Comment shikimate dehydrogenase [Metallosphaera sedula DSM 5348]
Sequence
MRVSLSNAWEVIELKCTEIGPDTSLLGVLGENIKYTLSPKIHNFAFERLGIRAVYVTFDV
SRDRFQRAFPGLLEFTYGLNVTIPYKEAVMPFLDSLSPEAEKVGAVNTIHGGRGYNTDYL
AVKGLVSGVERGTALILGAGGAAKAASFALGELGFEIIVQNRTETRGMELVSRLREEGIS
ASFSRACQGEYNVVVNTIPEPEAVPLECVRGKMAVEFVYKEETPFLRRARELGMRVVDGL
QILVRQAMEAEKIWFGKSLNDIEVVNFLNAGK
Download sequence
Identical sequences A0A088E7N0 A4YHW2
WP_012021801.1.15515 WP_012021801.1.27320 WP_012021801.1.28583 WP_012021801.1.31166 WP_012021801.1.34633 WP_012021801.1.8883 WP_012021801.1.99084 gi|146304622|ref|YP_001191938.1| 399549.Msed_1874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]