SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304644|ref|YP_001191960.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304644|ref|YP_001191960.1|
Domain Number 1 Region: 14-150
Classification Level Classification E-value
Superfamily Nqo5-like 4.32e-39
Family Nqo5-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304644|ref|YP_001191960.1|
Sequence length 160
Comment NADH dehydrogenase subunit C [Metallosphaera sedula DSM 5348]
Sequence
MSEKPIDLVVKLLQERKIPLKVEGDTRGSIEVDKSKLVETAKVLKELGFDHVKAVTGIDY
PDQAKFQVVYHVSSFDLQLSKVIIALKTWTSYKEPVVPSLLSVWGSVWTGERETYEMLGI
TFEGNPDMRRLFLPEDFEGVYPLRKSFKVKTEGLFVDKSS
Download sequence
Identical sequences A0A088E9M7 A4YHY4
WP_012021823.1.15515 WP_012021823.1.27320 WP_012021823.1.28583 WP_012021823.1.31166 WP_012021823.1.34633 WP_012021823.1.8883 WP_012021823.1.99084 gi|146304644|ref|YP_001191960.1| 399549.Msed_1896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]