SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304664|ref|YP_001191980.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304664|ref|YP_001191980.1|
Domain Number 1 Region: 82-190
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 1.7e-16
Family V-type ATPase subunit E 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304664|ref|YP_001191980.1|
Sequence length 192
Comment H+-transporting two-sector ATPase subunit E [Metallosphaera sedula DSM 5348]
Sequence
MVSVEELMGQVIDSEMEVISKELSKALEEALNLVKQKRDSVERTYTAKMQEMVTKAKEEI
EGERARLDIEVKRAVLGEKNYWLNKVYEGTIKSLGTVKNSQGYKQGLESVLKRELRDGSI
VYCSEDEVDQVQKMIKGLKAKAEVRSDPKIMGGVKIQYSDVGLVRDYSLNLILDQVFESL
KPKIAEILFGEM
Download sequence
Identical sequences A0A088E9Q1 A4YI04
WP_012021843.1.15515 WP_012021843.1.27320 WP_012021843.1.28583 WP_012021843.1.31166 WP_012021843.1.34633 WP_012021843.1.8883 WP_012021843.1.99084 399549.Msed_1916 gi|146304664|ref|YP_001191980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]