SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304696|ref|YP_001192012.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304696|ref|YP_001192012.1|
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 3.36e-25
Family HisE-like (PRA-PH) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304696|ref|YP_001192012.1|
Sequence length 93
Comment phosphoribosyl-ATP pyrophosphatase [Metallosphaera sedula DSM 5348]
Sequence
MTDVLEELSGIIAQRLREMPEGSYTASLAKKGKGYVARKVGEEAVEVVVASLSEGRERVV
SETADLIYHLLVLLAMEGISLDEVRDELRRRMK
Download sequence
Identical sequences A0A088E8R1 A4YI36
399549.Msed_1948 WP_012021875.1.15515 WP_012021875.1.27320 WP_012021875.1.28583 WP_012021875.1.31166 WP_012021875.1.34633 WP_012021875.1.8883 WP_012021875.1.99084 gi|146304696|ref|YP_001192012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]