SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304836|ref|YP_001192152.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304836|ref|YP_001192152.1|
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-60
Family Extended AAA-ATPase domain 0.000000356
Further Details:      
 
Domain Number 2 Region: 430-554
Classification Level Classification E-value
Superfamily vWA-like 1.45e-20
Family Integrin A (or I) domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304836|ref|YP_001192152.1|
Sequence length 600
Comment protoporphyrin IX magnesium-chelatase [Metallosphaera sedula DSM 5348]
Sequence
MRSFPFSAIVGQERLKKALLLVAVDPTITGVLIKGPKGVAKSTAVRALANLLPEIEVVAD
CPFSCDPDHRERMCNGCRARVDQGQRLPRARRRMRIVELPVSATLDRVVGTLDIKRVLKE
GERGLEPGLLALANRGILYIDEVNLLPDEVVNAILDAAASKFNVVEREGISIIHPADFIL
IGTMNPEEGELRPQLLDRFAISVEAESPGSPEELIEISKRVEEFERNPEEFLSKYQEEEA
QLREKILKAKEILPTVKIPDKLMQYLAEEILSQSSSTRAMIAAVKVAKALAALSGKTEVD
EEEAKQALEFVLHHRVSERRASARSSSLPRNQGEVQGNTTSDTNSSGGSRQEKQEQEINL
SIKPDLPKTKSPGTGFGKGGIFDTITGRFRGGGIHLDLHSSLINMALDRRNWLNPDDLVM
KSLETQGAIPILLLLDSSRSMDFSRRILVAKAILRELLQKAYQVRSKVGLVTFSGSEARY
DVPLTRNLRKVEEFVNGVRPAGKTPMSMALYLALQIVNRERRSRRKLNPLVFLISDGKAN
VSLGGNILQELEYFSIKLGEVSKFIVIDTGSPYQPSFNPTLAERAHGLLLRGSDFVDNLH
Download sequence
Identical sequences A0A088E783 A4YIH6
WP_012022015.1.15515 WP_012022015.1.27320 WP_012022015.1.28583 WP_012022015.1.31166 WP_012022015.1.34633 WP_012022015.1.8883 WP_012022015.1.99084 399549.Msed_2088 gi|146304836|ref|YP_001192152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]