SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304865|ref|YP_001192181.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304865|ref|YP_001192181.1|
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000878
Family Homeodomain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304865|ref|YP_001192181.1|
Sequence length 118
Comment hypothetical protein Msed_2118 [Metallosphaera sedula DSM 5348]
Sequence
MRAVHNISKECREKIVALLLEKRSKSELARDLGVSPASIVKFYKGRTHASDLTILRALSI
ADEEEKKYIARLIVDDLAESLLDLLSENQDLQSEKLDILKKVLDERDKRKILTSLGLV
Download sequence
Identical sequences A0A088EAA9 A4YIK5
gi|146304865|ref|YP_001192181.1| WP_012022044.1.15515 WP_012022044.1.27320 WP_012022044.1.28583 WP_012022044.1.31166 WP_012022044.1.34633 WP_012022044.1.8883 WP_012022044.1.99084 399549.Msed_2118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]