SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304931|ref|YP_001192247.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304931|ref|YP_001192247.1|
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000869
Family Recombinase DNA-binding domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304931|ref|YP_001192247.1|
Sequence length 116
Comment hypothetical protein Msed_2184 [Metallosphaera sedula DSM 5348]
Sequence
MLTDVTKLDDEQRRRILKKLVEKLGLAQTAKLLEIGRSTLYRYVNTNQNIPLEIVRKAAD
MLTPDELSDVIYGLKVVEVDATTALSVVIKAMKDEKFRNFFVSVLYQYLGEYLKNT
Download sequence
Identical sequences A0A088E7G5 A4YIS1
399549.Msed_2184 WP_012022110.1.15515 WP_012022110.1.27320 WP_012022110.1.28583 WP_012022110.1.31166 WP_012022110.1.34633 WP_012022110.1.8883 WP_012022110.1.99084 gi|146304931|ref|YP_001192247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]