SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304933|ref|YP_001192249.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304933|ref|YP_001192249.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.01e-46
Family Transposase IS200-like 0.000000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304933|ref|YP_001192249.1|
Sequence length 137
Comment transposase IS200-family protein [Metallosphaera sedula DSM 5348]
Sequence
MELKSTRHVKYLCNYHFVWIPKYRIAILTNKVAEYTKEVLKSIAKELGCEIIALEVMPDH
IHLFINCPPRYSPSYLANYFKGKSARLILKKFPELRKYKKLWSRSYFVSTAGNVSSETIK
KYIEEQWVKEGEEGQHS
Download sequence
Identical sequences A0A088E8F7 A4YIS3
399549.Msed_2186 WP_012022112.1.15515 WP_012022112.1.27320 WP_012022112.1.28583 WP_012022112.1.31166 WP_012022112.1.34633 WP_012022112.1.8883 WP_012022112.1.99084 gi|146304933|ref|YP_001192249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]