SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304935|ref|YP_001192251.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|146304935|ref|YP_001192251.1|
Domain Number - Region: 60-108
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.0196
Family Cation efflux protein transmembrane domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304935|ref|YP_001192251.1|
Sequence length 200
Comment hypothetical protein Msed_2188 [Metallosphaera sedula DSM 5348]
Sequence
MRKFNYNEIVVLNPLQTRYQMVSSRVFVPLYAAANDGIYRMNRRKFVTKYGPKTIGTYML
GTFGVLILLIGIGIAVYPFTPTTGMTSVDGLIAMLIGGLMLYFARKNASKLNQRISEEKG
MEGEIVLLWSQVKTITVMNVRQENVANRPSLVLNTVAPTYKEIGDWHVLTTDGRDVTIPN
VDDPYNKLNYVKNRFDLSFL
Download sequence
Identical sequences A0A088EAH2 A4YIS5
gi|146304935|ref|YP_001192251.1| 399549.Msed_2188 WP_012022114.1.15515 WP_012022114.1.27320 WP_012022114.1.28583 WP_012022114.1.31166 WP_012022114.1.34633 WP_012022114.1.8883 WP_012022114.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]