SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150015058|ref|YP_001307312.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150015058|ref|YP_001307312.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.27e-35
Family Ribosomal protein L6 0.0000299
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.35e-26
Family Ribosomal protein L6 0.0000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150015058|ref|YP_001307312.1|
Sequence length 180
Comment 50S ribosomal protein L6 [Clostridium beijerinckii NCIMB 8052]
Sequence
MSRVGRLPIAIPADVTVTVTPDNLVTVKGPKGELVKTMHKDISIAVENNEVIVTRHSEQK
DHRALHGLTRALINNMVIGVKQGYQKTLDLVGVGYRAQLQGKKLVMNLGYSHPVEIEPID
GITFETPAATRVIVSGIDKEKVGFAAADIRKWRVPEPYKGKGIKYENEVIRRKEGKTGKK
Download sequence
Identical sequences A0A0B5Q7D8 A0A0K2MKH1 A0A202CS28 A6LPS6
WP_011967521.1.13860 WP_011967521.1.15846 WP_011967521.1.16915 WP_011967521.1.1793 WP_011967521.1.2274 WP_011967521.1.24330 WP_011967521.1.27559 WP_011967521.1.33930 WP_011967521.1.35420 WP_011967521.1.41106 WP_011967521.1.44456 WP_011967521.1.46861 WP_011967521.1.48361 WP_011967521.1.51202 WP_011967521.1.65774 WP_011967521.1.6721 WP_011967521.1.88565 WP_011967521.1.91641 WP_011967521.1.95078 WP_011967521.1.96201 gi|150015058|ref|YP_001307312.1| 290402.Cbei_0166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]