SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150015270|ref|YP_001307524.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150015270|ref|YP_001307524.1|
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.05e-35
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150015270|ref|YP_001307524.1|
Sequence length 102
Comment PTS system lactose/cellobiose-specific transporter subunit IIA [Clostridium beijerinckii NCIMB 8052]
Sequence
MEEIILNIIMHSGEARTFSMEAITLAKQGNFDKAKGLIIKADEELGYAHNSQTSLIQGEA
VNEKIEFSLLLVHAQDHLMTTMVLKDLAVELIEVHEKISSIK
Download sequence
Identical sequences A0A0B5QGJ2 A0A0K2MJM8 A0A202CPU6 A6LQD8
gi|150015270|ref|YP_001307524.1| WP_011967729.1.13860 WP_011967729.1.15846 WP_011967729.1.16915 WP_011967729.1.1793 WP_011967729.1.2274 WP_011967729.1.24330 WP_011967729.1.27559 WP_011967729.1.33930 WP_011967729.1.41106 WP_011967729.1.44456 WP_011967729.1.46861 WP_011967729.1.48361 WP_011967729.1.51202 WP_011967729.1.65774 WP_011967729.1.6721 WP_011967729.1.88565 WP_011967729.1.91641 WP_011967729.1.95078 WP_011967729.1.96201 290402.Cbei_0380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]