SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150019450|ref|YP_001311704.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150019450|ref|YP_001311704.1|
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.58e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150019450|ref|YP_001311704.1|
Sequence length 106
Comment PTS system lactose/cellobiose-specific transporter subunit IIA [Clostridium beijerinckii NCIMB 8052]
Sequence
MDQLEMAIMNIIINAGDCKNHAYMALSLVNEGKYEEAENEMQLANDALGKAHDAQTEMLQ
KEASGEKVELSVLFVHAQDHLMTSISEKNLIEQIIELRKIVNTLVK
Download sequence
Identical sequences A0A0K2M853 A0A1S8NV57 A6M2B8
gi|150019450|ref|YP_001311704.1| 290402.Cbei_4640 WP_012060795.1.24330 WP_012060795.1.35420 WP_012060795.1.44456 WP_012060795.1.46861 WP_012060795.1.51202 WP_012060795.1.65774 WP_012060795.1.6721 WP_012060795.1.88565 WP_012060795.1.91641 WP_012060795.1.95078 WP_012060795.1.96201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]