SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150019495|ref|YP_001311749.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150019495|ref|YP_001311749.1|
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.75e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150019495|ref|YP_001311749.1|
Sequence length 107
Comment PTS system lactose/cellobiose-specific transporter subunit IIA [Clostridium beijerinckii NCIMB 8052]
Sequence
MEELELAIMNIIINAGDCKNHAYMALNSVNEGNYEEAEKEMQLANDALAKAHEGQTMFLH
KEANGEKVDISVLFVHAQDHLMTAITEKNLIEQIMELRKIINTLVKQ
Download sequence
Identical sequences A0A1S8SE62 A6M2G3
290402.Cbei_4685 WP_012060839.1.44456 WP_012060839.1.46861 WP_012060839.1.51202 WP_012060839.1.88565 WP_012060839.1.91641 gi|150019495|ref|YP_001311749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]