SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153951214|ref|YP_001397883.1| from Campylobacter jejuni subsp. doylei 269.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153951214|ref|YP_001397883.1|
Domain Number 1 Region: 73-224
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000424
Family N-acetyl transferase, NAT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153951214|ref|YP_001397883.1|
Sequence length 239
Comment arginyl-tRNA-protein transferase [Campylobacter jejuni subsp. doylei 269.97]
Sequence
MLEIGFCTLEDQCPYLKDKRSRIEYKYIENCPKEINNELIKRGWRRFGRYFSRPICKDCD
ECLSLRILVNEYHFSRSERRVINKNINTKVILRMPNLSNEHLFLYDKYHRFMEEKKDWKR
YDLSFKQYCNLYVDGFMNFGYELAFYIEDKLVCVDLIDILEDGISSIYCFYDPDFSYFSL
GKFSLLNEIQIAKKMNLDYIYLGYFVKKCQSLSYKADYTPSEILKGTKELFENEILWEK
Download sequence
Identical sequences A7H303
360109.JJD26997_0747 WP_011989991.1.67127 gi|153951214|ref|YP_001397883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]