SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153952231|ref|YP_001397946.1| from Campylobacter jejuni subsp. doylei 269.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153952231|ref|YP_001397946.1|
Domain Number 1 Region: 4-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.33e-26
Family N-acetyl transferase, NAT 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153952231|ref|YP_001397946.1|
Sequence length 159
Comment acetyltransferase [Campylobacter jejuni subsp. doylei 269.97]
Sequence
MSEFKIIDLRQEDLNILQEMIIEFAKYEDMLDFLQCTKEKLEHSLLKNKFARAFLLKENE
KTIGYMIYFYTFSSFWGSGGIYLEDIYIREDFRKKGYGKAVFKFLGEICKKENLKRLDWV
CLNDNILGINFYESLNAKHLKQWRNYRLSGENLEKLCDL
Download sequence
Identical sequences A7H366
360109.JJD26997_0819 gi|153952231|ref|YP_001397946.1| WP_011990049.1.67127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]