SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153947425|ref|YP_001400833.1| from Yersinia pseudotuberculosis IP 31758

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153947425|ref|YP_001400833.1|
Domain Number 1 Region: 35-151
Classification Level Classification E-value
Superfamily Superantigen (mitogen) Ypm 1.57e-76
Family Superantigen (mitogen) Ypm 0.000000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153947425|ref|YP_001400833.1|
Sequence length 151
Comment superantigen YpmA [Yersinia pseudotuberculosis IP 31758]
Sequence
MKNKLLSLLTFTLFSGVALATDYDNTLNSIPSLRIPNIATYTGTIQGKGEVCIIGNKEGK
TRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKI
KNNSSETSNYSLDATVHDDKEDSDVLTKCPV
Download sequence
Identical sequences A0A0U1QV71 Q57221
gi|153947425|ref|YP_001400833.1| 349747.YpsIP31758_1858 WP_012105075.1.12167 WP_012105075.1.14169 WP_012105075.1.41984 WP_012105075.1.47769 WP_012105075.1.52473 WP_012105075.1.58543 WP_012105075.1.6333 WP_012105075.1.89542 WP_012105075.1.91263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]