SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153947848|ref|YP_001401013.1| from Yersinia pseudotuberculosis IP 31758

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153947848|ref|YP_001401013.1|
Domain Number 1 Region: 3-244
Classification Level Classification E-value
Superfamily CutC-like 7.85e-76
Family CutC-like 0.0000000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153947848|ref|YP_001401013.1|
Sequence length 254
Comment copper homeostasis protein CutC [Yersinia pseudotuberculosis IP 31758]
Sequence
MTKLEVCCYSVDCAQIAEKAGADRVELCCGQSEGGLTPSVGALIQARETVTIPVHPIVRP
RGGDFCYSSNDFTIMKNDIARIRDLGFAGVVVGVLDTDGHIDMPRMREIMSVSGSLAVTF
HRAFDMCQNPMIALKQLAELNVARILTSGQQQNAELGLALLKDLVAATKDQGPIIMAGAG
VRLTNMQKFIDAGIRELHSSAGRTVPSTMRYRKAGVTMCADSDVDEFSHYCVDGEVVEAM
KSLLVMGSPLAKHT
Download sequence
Identical sequences A7FID5
WP_012105131.1.12167 WP_012105131.1.47769 WP_012105131.1.52473 WP_012105131.1.58543 WP_012105131.1.89542 WP_012105131.1.91263 gi|153947848|ref|YP_001401013.1| 349747.YpsIP31758_2040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]