SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153949664|ref|YP_001402904.1| from Yersinia pseudotuberculosis IP 31758

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153949664|ref|YP_001402904.1|
Domain Number 1 Region: 632-808
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.27e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 2-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.61e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0027
Further Details:      
 
Domain Number 3 Region: 501-626
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.6e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Weak hits

Sequence:  gi|153949664|ref|YP_001402904.1|
Domain Number - Region: 346-400
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0575
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153949664|ref|YP_001402904.1|
Sequence length 848
Comment nitrite reductase [NAD(P)H], large subunit [Yersinia pseudotuberculosis IP 31758]
Sequence
MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYDRVHLSSYFSHHTAEE
LSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDKLVMATGSYPWIPPIKG
SEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGALKSLGVETHVIEFAPVL
MAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRKTMLFADGTQLEVDFIVFS
TGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGECASWQERTFGLVAPGYKMA
QVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRTEGARSYVYLDESKEIYKRLV
VSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDSLILPAHAGNKPTIGVDSLPDS
AQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGCGGCIPLVTQVLNAELSKQGIEV
NNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKGYGCEVCKPTVGSLLASCWNEYVL
EPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEITPDGLLVVGQIAKEYNLYTKLTGSQ
RIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALRMAKTCVGSTWCRFGVGDSVGFGVAL
EHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGIIATENGWNLYVCGNGGMKPRHADLLA
ADLDEETLMRYLDRFMMFYIRTADKLQRTSVWLESLEGGIRYLQSVILEDKLGINDQLEA
EIARLRDKVACEWKATVENPAAQVRFAHFINSSLRDPNVQVVREREQHRPARPDERIPVR
VLELEDNA
Download sequence
Identical sequences A0A0U1R0H5
WP_012105879.1.20380 WP_012105879.1.39858 WP_012105879.1.42361 WP_012105879.1.52473 WP_012105879.1.58543 WP_012105879.1.6333 gi|153949664|ref|YP_001402904.1| 349747.YpsIP31758_3956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]