SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121637817|ref|YP_978040.1| from Mycobacterium bovis BCG str. Pasteur 1173P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121637817|ref|YP_978040.1|
Domain Number 1 Region: 56-200
Classification Level Classification E-value
Superfamily PEBP-like 5.23e-37
Family Prokaryotic PEBP-like proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121637817|ref|YP_978040.1|
Sequence length 201
Comment lipoprotein lppC [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence
MTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIAS
PMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPG
SGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQ
AAQAIAQAASGQARLVGTFEG
Download sequence
Identical sequences A0A0E8VEB4 A0A0H3M510 A0A109S7Y4 A0A109SNM9 A0A197IXV4 A0A1A9E7R3 A0A1S1BER4 A5U3T0 F8MA54 M8DGK5 P67225 P9WFN3 R4M6R8
gi|386004861|ref|YP_005923140.1| 233413.Mb1946c 336982.TBFG_11940 410289.BCG_1950c 419947.MRA_1922 561275.JTY_1934 83332.Rv1911c gi|121637817|ref|YP_978040.1| gi|383307730|ref|YP_005360541.1| gi|494696282|ref|YP_007961785.1| gi|479055869|ref|YP_007351675.1| gi|392386567|ref|YP_005308196.1| gi|148661719|ref|YP_001283242.1| gi|525674571|ref|YP_008226014.1| gi|15609048|ref|NP_216427.1| gi|433642046|ref|YP_007287805.1| gi|15609048|ref|NP_216427.1| NP_216427.1.84033 WP_003409568.1.100000 WP_003409568.1.100021 WP_003409568.1.100069 WP_003409568.1.100087 WP_003409568.1.10015 WP_003409568.1.100208 WP_003409568.1.100216 WP_003409568.1.10022 WP_003409568.1.100255 WP_003409568.1.100260 WP_003409568.1.100270 WP_003409568.1.100279 WP_003409568.1.100308 WP_003409568.1.100309 WP_003409568.1.100318 WP_003409568.1.100337 WP_003409568.1.100338 WP_003409568.1.10037 WP_003409568.1.100395 WP_003409568.1.100396 WP_003409568.1.1004 WP_003409568.1.100401 WP_003409568.1.100459 WP_003409568.1.100460 WP_003409568.1.100581 WP_003409568.1.100600 WP_003409568.1.100625 WP_003409568.1.10064 WP_003409568.1.100666 WP_003409568.1.100671 WP_003409568.1.100677 WP_003409568.1.100682 WP_003409568.1.100697 WP_003409568.1.100703 WP_003409568.1.100716 WP_003409568.1.100722 WP_003409568.1.100754 WP_003409568.1.100757 WP_003409568.1.100772 WP_003409568.1.1008 WP_003409568.1.100812 WP_003409568.1.100866 WP_003409568.1.10088 WP_003409568.1.100889 WP_003409568.1.10090 WP_003409568.1.100910 WP_003409568.1.100915 WP_003409568.1.100918 WP_003409568.1.100984 WP_003409568.1.100992 WP_003409568.1.100998 WP_003409568.1.101 WP_003409568.1.101025 WP_003409568.1.101028 WP_003409568.1.10104 WP_003409568.1.101054 WP_003409568.1.101075 WP_003409568.1.101143 WP_003409568.1.101146 WP_003409568.1.10116 WP_003409568.1.10117 WP_003409568.1.101209 WP_003409568.1.101290 WP_003409568.1.101323 WP_003409568.1.101324 WP_003409568.1.101350 WP_003409568.1.101367 WP_003409568.1.101398 WP_003409568.1.101403 WP_003409568.1.101421 WP_003409568.1.10144 WP_003409568.1.101442 WP_003409568.1.10145 WP_003409568.1.101456 WP_003409568.1.101481 WP_003409568.1.101493 WP_003409568.1.101496 WP_003409568.1.101525 WP_003409568.1.101533 WP_003409568.1.101535 WP_003409568.1.101553 WP_003409568.1.101558 WP_003409568.1.10156 WP_003409568.1.101573 WP_003409568.1.101576 WP_003409568.1.10159 WP_003409568.1.101592 WP_003409568.1.101604 WP_003409568.1.101607 WP_003409568.1.101622 WP_003409568.1.101644 WP_003409568.1.101659 WP_003409568.1.101671 WP_003409568.1.101687 WP_003409568.1.101698 WP_003409568.1.10170 WP_003409568.1.101713 WP_003409568.1.101722 WP_003409568.1.101743 WP_003409568.1.101753 WP_003409568.1.101754 WP_003409568.1.101764 WP_003409568.1.101773 WP_003409568.1.101795 WP_003409568.1.101797 WP_003409568.1.101798 WP_003409568.1.101802 WP_003409568.1.101826 WP_003409568.1.101836 WP_003409568.1.101858 WP_003409568.1.101859 WP_003409568.1.101862 WP_003409568.1.101888 WP_003409568.1.101894 WP_003409568.1.101899 WP_003409568.1.1019 WP_003409568.1.101923 WP_003409568.1.101925 WP_003409568.1.10193 WP_003409568.1.101996 WP_003409568.1.102 WP_003409568.1.102008 WP_003409568.1.102017 WP_003409568.1.102053 WP_003409568.1.102055 WP_003409568.1.102063 WP_003409568.1.102099 WP_003409568.1.1021 WP_003409568.1.10211 WP_003409568.1.102119 WP_003409568.1.102121 WP_003409568.1.102143 WP_003409568.1.10216 WP_003409568.1.10224 WP_003409568.1.10262 WP_003409568.1.10272 WP_003409568.1.10277 WP_003409568.1.1033 WP_003409568.1.10350 WP_003409568.1.10362 WP_003409568.1.10366 WP_003409568.1.10376 WP_003409568.1.10396 WP_003409568.1.10410 WP_003409568.1.10414 WP_003409568.1.10421 WP_003409568.1.10430 WP_003409568.1.10440 WP_003409568.1.10471 WP_003409568.1.10472 WP_003409568.1.10489 WP_003409568.1.105 WP_003409568.1.10518 WP_003409568.1.10523 WP_003409568.1.10545 WP_003409568.1.1057 WP_003409568.1.10594 WP_003409568.1.10603 WP_003409568.1.10606 WP_003409568.1.10615 WP_003409568.1.10623 WP_003409568.1.10635 WP_003409568.1.10643 WP_003409568.1.10648 WP_003409568.1.10662 WP_003409568.1.10709 WP_003409568.1.10735 WP_003409568.1.10740 WP_003409568.1.10756 WP_003409568.1.1078 WP_003409568.1.10791 WP_003409568.1.10799 WP_003409568.1.10825 WP_003409568.1.10848 WP_003409568.1.10863 WP_003409568.1.10879 WP_003409568.1.10912 WP_003409568.1.10916 WP_003409568.1.10923 WP_003409568.1.10927 WP_003409568.1.1095 WP_003409568.1.10956 WP_003409568.1.10958 WP_003409568.1.10962 WP_003409568.1.10980 WP_003409568.1.10981 WP_003409568.1.10993 WP_003409568.1.1100 WP_003409568.1.11040 WP_003409568.1.11061 WP_003409568.1.11070 WP_003409568.1.11141 WP_003409568.1.11171 WP_003409568.1.11176 WP_003409568.1.11222 WP_003409568.1.11236 WP_003409568.1.11329 WP_003409568.1.1133 WP_003409568.1.11342 WP_003409568.1.11373 WP_003409568.1.11390 WP_003409568.1.11402 WP_003409568.1.11481 WP_003409568.1.11487 WP_003409568.1.11489 WP_003409568.1.11491 WP_003409568.1.11514 WP_003409568.1.11587 WP_003409568.1.11589 WP_003409568.1.11596 WP_003409568.1.11604 WP_003409568.1.11610 WP_003409568.1.11697 WP_003409568.1.11707 WP_003409568.1.11752 WP_003409568.1.11758 WP_003409568.1.11761 WP_003409568.1.11775 WP_003409568.1.11822 WP_003409568.1.11826 WP_003409568.1.11856 WP_003409568.1.11898 WP_003409568.1.11906 WP_003409568.1.11960 WP_003409568.1.11961 WP_003409568.1.11972 WP_003409568.1.11984 WP_003409568.1.120 WP_003409568.1.12001 WP_003409568.1.12049 WP_003409568.1.12052 WP_003409568.1.12100 WP_003409568.1.12116 WP_003409568.1.12130 WP_003409568.1.12133 WP_003409568.1.12161 WP_003409568.1.12165 WP_003409568.1.12184 WP_003409568.1.12187 WP_003409568.1.12190 WP_003409568.1.12216 WP_003409568.1.12275 WP_003409568.1.12293 WP_003409568.1.12294 WP_003409568.1.123 WP_003409568.1.1231 WP_003409568.1.12314 WP_003409568.1.12327 WP_003409568.1.12338 WP_003409568.1.1236 WP_003409568.1.12371 WP_003409568.1.12372 WP_003409568.1.12389 WP_003409568.1.12406 WP_003409568.1.1241 WP_003409568.1.12421 WP_003409568.1.12424 WP_003409568.1.12446 WP_003409568.1.12464 WP_003409568.1.12479 WP_003409568.1.12519 WP_003409568.1.12523 WP_003409568.1.12526 WP_003409568.1.1255 WP_003409568.1.12550 WP_003409568.1.12551 WP_003409568.1.12611 WP_003409568.1.12669 WP_003409568.1.1267 WP_003409568.1.12672 WP_003409568.1.12692 WP_003409568.1.1271 WP_003409568.1.12710 WP_003409568.1.12768 WP_003409568.1.1279 WP_003409568.1.12794 WP_003409568.1.12801 WP_003409568.1.12804 WP_003409568.1.12841 WP_003409568.1.12854 WP_003409568.1.12871 WP_003409568.1.12901 WP_003409568.1.12941 WP_003409568.1.12947 WP_003409568.1.12957 WP_003409568.1.12972 WP_003409568.1.13028 WP_003409568.1.13043 WP_003409568.1.13086 WP_003409568.1.13087 WP_003409568.1.13090 WP_003409568.1.13096 WP_003409568.1.13163 WP_003409568.1.13175 WP_003409568.1.13183 WP_003409568.1.132 WP_003409568.1.13249 WP_003409568.1.13282 WP_003409568.1.13284 WP_003409568.1.13296 WP_003409568.1.13298 WP_003409568.1.13302 WP_003409568.1.13306 WP_003409568.1.13312 WP_003409568.1.13313 WP_003409568.1.13321 WP_003409568.1.13345 WP_003409568.1.13375 WP_003409568.1.1338 WP_003409568.1.13420 WP_003409568.1.13433 WP_003409568.1.13435 WP_003409568.1.13438 WP_003409568.1.13461 WP_003409568.1.13466 WP_003409568.1.13526 WP_003409568.1.13551 WP_003409568.1.13561 WP_003409568.1.13564 WP_003409568.1.13579 WP_003409568.1.13647 WP_003409568.1.13687 WP_003409568.1.13697 WP_003409568.1.13719 WP_003409568.1.13763 WP_003409568.1.1377 WP_003409568.1.13774 WP_003409568.1.13786 WP_003409568.1.13793 WP_003409568.1.13794 WP_003409568.1.13817 WP_003409568.1.13834 WP_003409568.1.13866 WP_003409568.1.13880 WP_003409568.1.13899 WP_003409568.1.13909 WP_003409568.1.13910 WP_003409568.1.13919 WP_003409568.1.13920 WP_003409568.1.13952 WP_003409568.1.13953 WP_003409568.1.13962 WP_003409568.1.1398 WP_003409568.1.13988 WP_003409568.1.14027 WP_003409568.1.14046 WP_003409568.1.14115 WP_003409568.1.1415 WP_003409568.1.14152 WP_003409568.1.14158 WP_003409568.1.14162 WP_003409568.1.14175 WP_003409568.1.14178 WP_003409568.1.14194 WP_003409568.1.14195 WP_003409568.1.14208 WP_003409568.1.14238 WP_003409568.1.14266 WP_003409568.1.14273 WP_003409568.1.14303 WP_003409568.1.14306 WP_003409568.1.14307 WP_003409568.1.14310 WP_003409568.1.14341 WP_003409568.1.14382 WP_003409568.1.14416 WP_003409568.1.14428 WP_003409568.1.14441 WP_003409568.1.14469 WP_003409568.1.14477 WP_003409568.1.14514 WP_003409568.1.1452 WP_003409568.1.14527 WP_003409568.1.1454 WP_003409568.1.14544 WP_003409568.1.14548 WP_003409568.1.14551 WP_003409568.1.14561 WP_003409568.1.14573 WP_003409568.1.1462 WP_003409568.1.14658 WP_003409568.1.14667 WP_003409568.1.14668 WP_003409568.1.14675 WP_003409568.1.14694 WP_003409568.1.14695 WP_003409568.1.14766 WP_003409568.1.14783 WP_003409568.1.14865 WP_003409568.1.14872 WP_003409568.1.14905 WP_003409568.1.14926 WP_003409568.1.14951 WP_003409568.1.15003 WP_003409568.1.15009 WP_003409568.1.15028 WP_003409568.1.15040 WP_003409568.1.15052 WP_003409568.1.15065 WP_003409568.1.15072 WP_003409568.1.15089 WP_003409568.1.1509 WP_003409568.1.15126 WP_003409568.1.15131 WP_003409568.1.15168 WP_003409568.1.15172 WP_003409568.1.15174 WP_003409568.1.15187 WP_003409568.1.15196 WP_003409568.1.15210 WP_003409568.1.15216 WP_003409568.1.15217 WP_003409568.1.1523 WP_003409568.1.15232 WP_003409568.1.15238 WP_003409568.1.15240 WP_003409568.1.15253 WP_003409568.1.15267 WP_003409568.1.1527 WP_003409568.1.15292 WP_003409568.1.15299 WP_003409568.1.15302 WP_003409568.1.15322 WP_003409568.1.1534 WP_003409568.1.15345 WP_003409568.1.15365 WP_003409568.1.15372 WP_003409568.1.15386 WP_003409568.1.15387 WP_003409568.1.15442 WP_003409568.1.15447 WP_003409568.1.15449 WP_003409568.1.15477 WP_003409568.1.15492 WP_003409568.1.15511 WP_003409568.1.15512 WP_003409568.1.15558 WP_003409568.1.15559 WP_003409568.1.15566 WP_003409568.1.15599 WP_003409568.1.1560 WP_003409568.1.15611 WP_003409568.1.1563 WP_003409568.1.15633 WP_003409568.1.15643 WP_003409568.1.15688 WP_003409568.1.15755 WP_003409568.1.15763 WP_003409568.1.15774 WP_003409568.1.1578 WP_003409568.1.15780 WP_003409568.1.15827 WP_003409568.1.15834 WP_003409568.1.15842 WP_003409568.1.15848 WP_003409568.1.15853 WP_003409568.1.15870 WP_003409568.1.15877 WP_003409568.1.15893 WP_003409568.1.15896 WP_003409568.1.15926 WP_003409568.1.15933 WP_003409568.1.15946 WP_003409568.1.15958 WP_003409568.1.15973 WP_003409568.1.15987 WP_003409568.1.15993 WP_003409568.1.16009 WP_003409568.1.16025 WP_003409568.1.16043 WP_003409568.1.16055 WP_003409568.1.16066 WP_003409568.1.16069 WP_003409568.1.16077 WP_003409568.1.16106 WP_003409568.1.16108 WP_003409568.1.16110 WP_003409568.1.16130 WP_003409568.1.16136 WP_003409568.1.16139 WP_003409568.1.16141 WP_003409568.1.1630 WP_003409568.1.16318 WP_003409568.1.1632 WP_003409568.1.16327 WP_003409568.1.16334 WP_003409568.1.16341 WP_003409568.1.16345 WP_003409568.1.16374 WP_003409568.1.16384 WP_003409568.1.16386 WP_003409568.1.164 WP_003409568.1.1642 WP_003409568.1.16421 WP_003409568.1.16424 WP_003409568.1.16426 WP_003409568.1.16431 WP_003409568.1.1644 WP_003409568.1.16442 WP_003409568.1.16448 WP_003409568.1.16451 WP_003409568.1.16476 WP_003409568.1.16480 WP_003409568.1.16494 WP_003409568.1.1652 WP_003409568.1.16549 WP_003409568.1.16560 WP_003409568.1.16598 WP_003409568.1.16609 WP_003409568.1.16619 WP_003409568.1.16620 WP_003409568.1.16622 WP_003409568.1.16637 WP_003409568.1.1669 WP_003409568.1.16707 WP_003409568.1.16724 WP_003409568.1.16731 WP_003409568.1.16743 WP_003409568.1.1683 WP_003409568.1.16837 WP_003409568.1.16852 WP_003409568.1.16937 WP_003409568.1.16940 WP_003409568.1.16950 WP_003409568.1.16959 WP_003409568.1.16968 WP_003409568.1.1697 WP_003409568.1.16973 WP_003409568.1.16977 WP_003409568.1.16987 WP_003409568.1.17005 WP_003409568.1.17006 WP_003409568.1.17010 WP_003409568.1.17015 WP_003409568.1.17019 WP_003409568.1.17039 WP_003409568.1.17041 WP_003409568.1.17052 WP_003409568.1.17057 WP_003409568.1.17062 WP_003409568.1.1707 WP_003409568.1.17094 WP_003409568.1.17130 WP_003409568.1.17138 WP_003409568.1.17147 WP_003409568.1.17167 WP_003409568.1.17224 WP_003409568.1.17251 WP_003409568.1.17288 WP_003409568.1.17304 WP_003409568.1.17314 WP_003409568.1.17345 WP_003409568.1.17381 WP_003409568.1.17391 WP_003409568.1.17412 WP_003409568.1.1743 WP_003409568.1.17440 WP_003409568.1.17466 WP_003409568.1.17477 WP_003409568.1.17483 WP_003409568.1.17505 WP_003409568.1.17527 WP_003409568.1.17535 WP_003409568.1.17540 WP_003409568.1.17553 WP_003409568.1.17558 WP_003409568.1.17599 WP_003409568.1.17635 WP_003409568.1.17655 WP_003409568.1.17679 WP_003409568.1.1768 WP_003409568.1.17687 WP_003409568.1.17700 WP_003409568.1.17710 WP_003409568.1.17713 WP_003409568.1.17722 WP_003409568.1.17746 WP_003409568.1.17788 WP_003409568.1.17798 WP_003409568.1.17803 WP_003409568.1.17816 WP_003409568.1.17821 WP_003409568.1.17830 WP_003409568.1.17868 WP_003409568.1.17878 WP_003409568.1.1792 WP_003409568.1.17923 WP_003409568.1.1795 WP_003409568.1.17955 WP_003409568.1.17973 WP_003409568.1.18009 WP_003409568.1.18013 WP_003409568.1.18033 WP_003409568.1.18057 WP_003409568.1.18065 WP_003409568.1.18070 WP_003409568.1.18116 WP_003409568.1.18120 WP_003409568.1.18126 WP_003409568.1.1817 WP_003409568.1.18170 WP_003409568.1.18216 WP_003409568.1.18240 WP_003409568.1.18257 WP_003409568.1.18297 WP_003409568.1.18306 WP_003409568.1.18399 WP_003409568.1.18411 WP_003409568.1.18444 WP_003409568.1.18448 WP_003409568.1.18467 WP_003409568.1.18522 WP_003409568.1.18580 WP_003409568.1.18582 WP_003409568.1.18587 WP_003409568.1.186 WP_003409568.1.18601 WP_003409568.1.18639 WP_003409568.1.18647 WP_003409568.1.1868 WP_003409568.1.18694 WP_003409568.1.18710 WP_003409568.1.18751 WP_003409568.1.18781 WP_003409568.1.18793 WP_003409568.1.18804 WP_003409568.1.18816 WP_003409568.1.18823 WP_003409568.1.18827 WP_003409568.1.18838 WP_003409568.1.18849 WP_003409568.1.18856 WP_003409568.1.1898 WP_003409568.1.19005 WP_003409568.1.19056 WP_003409568.1.19066 WP_003409568.1.19071 WP_003409568.1.19085 WP_003409568.1.19094 WP_003409568.1.19144 WP_003409568.1.19159 WP_003409568.1.19193 WP_003409568.1.19231 WP_003409568.1.19243 WP_003409568.1.19264 WP_003409568.1.19295 WP_003409568.1.19307 WP_003409568.1.19326 WP_003409568.1.1933 WP_003409568.1.19400 WP_003409568.1.19426 WP_003409568.1.19429 WP_003409568.1.19464 WP_003409568.1.19480 WP_003409568.1.19512 WP_003409568.1.19553 WP_003409568.1.19562 WP_003409568.1.19564 WP_003409568.1.19568 WP_003409568.1.19572 WP_003409568.1.19595 WP_003409568.1.19600 WP_003409568.1.19630 WP_003409568.1.1967 WP_003409568.1.19694 WP_003409568.1.1970 WP_003409568.1.19707 WP_003409568.1.19742 WP_003409568.1.19785 WP_003409568.1.19820 WP_003409568.1.19868 WP_003409568.1.19874 WP_003409568.1.19890 WP_003409568.1.19900 WP_003409568.1.19922 WP_003409568.1.19936 WP_003409568.1.19946 WP_003409568.1.19949 WP_003409568.1.19960 WP_003409568.1.19964 WP_003409568.1.20016 WP_003409568.1.20028 WP_003409568.1.2003 WP_003409568.1.20037 WP_003409568.1.20039 WP_003409568.1.20082 WP_003409568.1.20085 WP_003409568.1.20097 WP_003409568.1.20116 WP_003409568.1.20130 WP_003409568.1.20140 WP_003409568.1.20141 WP_003409568.1.20158 WP_003409568.1.20239 WP_003409568.1.20243 WP_003409568.1.20259 WP_003409568.1.20262 WP_003409568.1.20268 WP_003409568.1.20273 WP_003409568.1.20280 WP_003409568.1.20294 WP_003409568.1.20300 WP_003409568.1.20309 WP_003409568.1.20322 WP_003409568.1.2037 WP_003409568.1.20372 WP_003409568.1.20381 WP_003409568.1.204 WP_003409568.1.20427 WP_003409568.1.20432 WP_003409568.1.20457 WP_003409568.1.20459 WP_003409568.1.20460 WP_003409568.1.20542 WP_003409568.1.20578 WP_003409568.1.20608 WP_003409568.1.20624 WP_003409568.1.20628 WP_003409568.1.2066 WP_003409568.1.20707 WP_003409568.1.20722 WP_003409568.1.20729 WP_003409568.1.20742 WP_003409568.1.20776 WP_003409568.1.20843 WP_003409568.1.20850 WP_003409568.1.2086 WP_003409568.1.20868 WP_003409568.1.20897 WP_003409568.1.20898 WP_003409568.1.2090 WP_003409568.1.20911 WP_003409568.1.20916 WP_003409568.1.20921 WP_003409568.1.20926 WP_003409568.1.20927 WP_003409568.1.20951 WP_003409568.1.20970 WP_003409568.1.2104 WP_003409568.1.21070 WP_003409568.1.21127 WP_003409568.1.21135 WP_003409568.1.21173 WP_003409568.1.21187 WP_003409568.1.212 WP_003409568.1.2120 WP_003409568.1.21218 WP_003409568.1.21219 WP_003409568.1.2123 WP_003409568.1.21231 WP_003409568.1.21234 WP_003409568.1.2126 WP_003409568.1.21292 WP_003409568.1.21307 WP_003409568.1.2131 WP_003409568.1.21311 WP_003409568.1.21321 WP_003409568.1.21365 WP_003409568.1.2137 WP_003409568.1.21392 WP_003409568.1.21397 WP_003409568.1.21415 WP_003409568.1.21418 WP_003409568.1.21430 WP_003409568.1.21434 WP_003409568.1.21444 WP_003409568.1.21468 WP_003409568.1.21498 WP_003409568.1.21509 WP_003409568.1.21513 WP_003409568.1.21560 WP_003409568.1.21565 WP_003409568.1.21586 WP_003409568.1.21591 WP_003409568.1.21594 WP_003409568.1.21602 WP_003409568.1.21615 WP_003409568.1.21638 WP_003409568.1.21639 WP_003409568.1.21655 WP_003409568.1.21658 WP_003409568.1.2168 WP_003409568.1.2174 WP_003409568.1.21741 WP_003409568.1.21742 WP_003409568.1.21777 WP_003409568.1.21786 WP_003409568.1.21795 WP_003409568.1.218 WP_003409568.1.21826 WP_003409568.1.21829 WP_003409568.1.21840 WP_003409568.1.21843 WP_003409568.1.21872 WP_003409568.1.21873 WP_003409568.1.2188 WP_003409568.1.21882 WP_003409568.1.21906 WP_003409568.1.21912 WP_003409568.1.2194 WP_003409568.1.21941 WP_003409568.1.21956 WP_003409568.1.21958 WP_003409568.1.21960 WP_003409568.1.21971 WP_003409568.1.21973 WP_003409568.1.21983 WP_003409568.1.22003 WP_003409568.1.22013 WP_003409568.1.22025 WP_003409568.1.22036 WP_003409568.1.22075 WP_003409568.1.22092 WP_003409568.1.2212 WP_003409568.1.22127 WP_003409568.1.22140 WP_003409568.1.22233 WP_003409568.1.22255 WP_003409568.1.22277 WP_003409568.1.22305 WP_003409568.1.22348 WP_003409568.1.22356 WP_003409568.1.2238 WP_003409568.1.22380 WP_003409568.1.22437 WP_003409568.1.22438 WP_003409568.1.22445 WP_003409568.1.22490 WP_003409568.1.22511 WP_003409568.1.22524 WP_003409568.1.2253 WP_003409568.1.22585 WP_003409568.1.22589 WP_003409568.1.22606 WP_003409568.1.22608 WP_003409568.1.22609 WP_003409568.1.22618 WP_003409568.1.22624 WP_003409568.1.22629 WP_003409568.1.22647 WP_003409568.1.22664 WP_003409568.1.22665 WP_003409568.1.22670 WP_003409568.1.22674 WP_003409568.1.22725 WP_003409568.1.22728 WP_003409568.1.22733 WP_003409568.1.22737 WP_003409568.1.2275 WP_003409568.1.22754 WP_003409568.1.22797 WP_003409568.1.22800 WP_003409568.1.22804 WP_003409568.1.22829 WP_003409568.1.22840 WP_003409568.1.22844 WP_003409568.1.22963 WP_003409568.1.22970 WP_003409568.1.22996 WP_003409568.1.22997 WP_003409568.1.22999 WP_003409568.1.23015 WP_003409568.1.23032 WP_003409568.1.231 WP_003409568.1.23101 WP_003409568.1.2312 WP_003409568.1.23140 WP_003409568.1.23153 WP_003409568.1.23171 WP_003409568.1.23199 WP_003409568.1.2320 WP_003409568.1.23204 WP_003409568.1.23216 WP_003409568.1.23229 WP_003409568.1.23233 WP_003409568.1.2326 WP_003409568.1.23261 WP_003409568.1.23272 WP_003409568.1.23289 WP_003409568.1.2329 WP_003409568.1.23308 WP_003409568.1.23316 WP_003409568.1.23321 WP_003409568.1.23325 WP_003409568.1.2339 WP_003409568.1.23406 WP_003409568.1.23438 WP_003409568.1.23445 WP_003409568.1.23447 WP_003409568.1.23452 WP_003409568.1.23461 WP_003409568.1.2349 WP_003409568.1.23496 WP_003409568.1.23497 WP_003409568.1.23506 WP_003409568.1.23530 WP_003409568.1.23546 WP_003409568.1.23551 WP_003409568.1.23573 WP_003409568.1.23583 WP_003409568.1.23588 WP_003409568.1.23628 WP_003409568.1.23677 WP_003409568.1.23683 WP_003409568.1.23692 WP_003409568.1.23694 WP_003409568.1.23699 WP_003409568.1.2371 WP_003409568.1.23803 WP_003409568.1.23807 WP_003409568.1.23825 WP_003409568.1.23832 WP_003409568.1.2384 WP_003409568.1.23843 WP_003409568.1.23863 WP_003409568.1.2387 WP_003409568.1.23894 WP_003409568.1.23993 WP_003409568.1.2400 WP_003409568.1.24007 WP_003409568.1.24008 WP_003409568.1.24046 WP_003409568.1.24057 WP_003409568.1.24062 WP_003409568.1.24113 WP_003409568.1.24119 WP_003409568.1.24128 WP_003409568.1.24176 WP_003409568.1.24190 WP_003409568.1.24202 WP_003409568.1.24244 WP_003409568.1.24261 WP_003409568.1.24284 WP_003409568.1.24294 WP_003409568.1.24357 WP_003409568.1.24396 WP_003409568.1.24414 WP_003409568.1.24423 WP_003409568.1.2443 WP_003409568.1.24446 WP_003409568.1.24461 WP_003409568.1.24500 WP_003409568.1.24507 WP_003409568.1.24509 WP_003409568.1.24529 WP_003409568.1.24553 WP_003409568.1.24599 WP_003409568.1.24629 WP_003409568.1.24638 WP_003409568.1.24648 WP_003409568.1.2466 WP_003409568.1.24767 WP_003409568.1.24824 WP_003409568.1.24831 WP_003409568.1.24840 WP_003409568.1.24848 WP_003409568.1.24857 WP_003409568.1.2487 WP_003409568.1.24893 WP_003409568.1.24907 WP_003409568.1.24933 WP_003409568.1.24956 WP_003409568.1.24958 WP_003409568.1.24985 WP_003409568.1.2499 WP_003409568.1.25004 WP_003409568.1.25051 WP_003409568.1.2507 WP_003409568.1.25096 WP_003409568.1.25103 WP_003409568.1.25129 WP_003409568.1.25171 WP_003409568.1.25184 WP_003409568.1.25247 WP_003409568.1.25252 WP_003409568.1.25278 WP_003409568.1.25283 WP_003409568.1.25309 WP_003409568.1.25338 WP_003409568.1.25342 WP_003409568.1.25343 WP_003409568.1.25367 WP_003409568.1.25393 WP_003409568.1.25406 WP_003409568.1.25435 WP_003409568.1.25437 WP_003409568.1.25445 WP_003409568.1.25473 WP_003409568.1.25504 WP_003409568.1.25513 WP_003409568.1.25542 WP_003409568.1.25579 WP_003409568.1.25594 WP_003409568.1.25606 WP_003409568.1.25645 WP_003409568.1.2566 WP_003409568.1.25673 WP_003409568.1.25674 WP_003409568.1.25693 WP_003409568.1.25699 WP_003409568.1.25727 WP_003409568.1.25736 WP_003409568.1.25738 WP_003409568.1.25756 WP_003409568.1.25759 WP_003409568.1.2580 WP_003409568.1.25813 WP_003409568.1.25853 WP_003409568.1.25854 WP_003409568.1.25874 WP_003409568.1.25885 WP_003409568.1.25892 WP_003409568.1.25906 WP_003409568.1.25914 WP_003409568.1.25916 WP_003409568.1.2594 WP_003409568.1.25954 WP_003409568.1.25965 WP_003409568.1.25972 WP_003409568.1.26017 WP_003409568.1.26032 WP_003409568.1.26038 WP_003409568.1.26072 WP_003409568.1.26097 WP_003409568.1.26098 WP_003409568.1.26108 WP_003409568.1.26118 WP_003409568.1.26126 WP_003409568.1.2614 WP_003409568.1.26168 WP_003409568.1.26182 WP_003409568.1.26190 WP_003409568.1.2620 WP_003409568.1.26234 WP_003409568.1.26243 WP_003409568.1.26265 WP_003409568.1.26267 WP_003409568.1.26292 WP_003409568.1.26310 WP_003409568.1.26328 WP_003409568.1.26349 WP_003409568.1.26366 WP_003409568.1.26374 WP_003409568.1.26407 WP_003409568.1.26412 WP_003409568.1.26454 WP_003409568.1.26464 WP_003409568.1.2653 WP_003409568.1.26560 WP_003409568.1.26571 WP_003409568.1.26597 WP_003409568.1.26603 WP_003409568.1.26629 WP_003409568.1.26651 WP_003409568.1.26702 WP_003409568.1.26707 WP_003409568.1.26710 WP_003409568.1.26719 WP_003409568.1.26737 WP_003409568.1.26738 WP_003409568.1.26745 WP_003409568.1.26756 WP_003409568.1.2676 WP_003409568.1.2677 WP_003409568.1.26779 WP_003409568.1.26780 WP_003409568.1.26798 WP_003409568.1.26854 WP_003409568.1.26868 WP_003409568.1.26876 WP_003409568.1.26888 WP_003409568.1.26914 WP_003409568.1.26945 WP_003409568.1.26959 WP_003409568.1.26969 WP_003409568.1.26992 WP_003409568.1.27004 WP_003409568.1.27017 WP_003409568.1.27045 WP_003409568.1.27074 WP_003409568.1.27075 WP_003409568.1.27128 WP_003409568.1.27130 WP_003409568.1.27139 WP_003409568.1.27152 WP_003409568.1.27162 WP_003409568.1.27164 WP_003409568.1.27193 WP_003409568.1.27235 WP_003409568.1.27254 WP_003409568.1.27278 WP_003409568.1.27343 WP_003409568.1.27352 WP_003409568.1.27369 WP_003409568.1.27391 WP_003409568.1.27398 WP_003409568.1.27402 WP_003409568.1.27410 WP_003409568.1.27411 WP_003409568.1.27449 WP_003409568.1.27460 WP_003409568.1.27463 WP_003409568.1.27492 WP_003409568.1.27528 WP_003409568.1.27541 WP_003409568.1.27576 WP_003409568.1.27582 WP_003409568.1.27596 WP_003409568.1.27607 WP_003409568.1.2766 WP_003409568.1.27724 WP_003409568.1.27730 WP_003409568.1.27736 WP_003409568.1.27743 WP_003409568.1.27750 WP_003409568.1.27771 WP_003409568.1.27779 WP_003409568.1.27795 WP_003409568.1.27803 WP_003409568.1.27819 WP_003409568.1.27835 WP_003409568.1.27915 WP_003409568.1.27935 WP_003409568.1.27962 WP_003409568.1.28053 WP_003409568.1.28131 WP_003409568.1.28142 WP_003409568.1.28159 WP_003409568.1.2816 WP_003409568.1.28161 WP_003409568.1.28192 WP_003409568.1.28202 WP_003409568.1.28241 WP_003409568.1.28242 WP_003409568.1.28251 WP_003409568.1.28255 WP_003409568.1.28269 WP_003409568.1.28276 WP_003409568.1.28293 WP_003409568.1.28331 WP_003409568.1.28367 WP_003409568.1.28378 WP_003409568.1.2842 WP_003409568.1.2847 WP_003409568.1.28471 WP_003409568.1.28473 WP_003409568.1.28493 WP_003409568.1.28497 WP_003409568.1.28530 WP_003409568.1.28561 WP_003409568.1.28567 WP_003409568.1.28585 WP_003409568.1.286 WP_003409568.1.28610 WP_003409568.1.28617 WP_003409568.1.28634 WP_003409568.1.28642 WP_003409568.1.28671 WP_003409568.1.28682 WP_003409568.1.28698 WP_003409568.1.28703 WP_003409568.1.28739 WP_003409568.1.28758 WP_003409568.1.28781 WP_003409568.1.28787 WP_003409568.1.28827 WP_003409568.1.28847 WP_003409568.1.28850 WP_003409568.1.28851 WP_003409568.1.28865 WP_003409568.1.28897 WP_003409568.1.28914 WP_003409568.1.28935 WP_003409568.1.28936 WP_003409568.1.28939 WP_003409568.1.28943 WP_003409568.1.28952 WP_003409568.1.28975 WP_003409568.1.2899 WP_003409568.1.28993 WP_003409568.1.29000 WP_003409568.1.2901 WP_003409568.1.29028 WP_003409568.1.29033 WP_003409568.1.29058 WP_003409568.1.29078 WP_003409568.1.29102 WP_003409568.1.29115 WP_003409568.1.2916 WP_003409568.1.29217 WP_003409568.1.29223 WP_003409568.1.29234 WP_003409568.1.29264 WP_003409568.1.29275 WP_003409568.1.29306 WP_003409568.1.29339 WP_003409568.1.29348 WP_003409568.1.29364 WP_003409568.1.2938 WP_003409568.1.29399 WP_003409568.1.29426 WP_003409568.1.2944 WP_003409568.1.29449 WP_003409568.1.29452 WP_003409568.1.2949 WP_003409568.1.29510 WP_003409568.1.29515 WP_003409568.1.29525 WP_003409568.1.2953 WP_003409568.1.29559 WP_003409568.1.29587 WP_003409568.1.2959 WP_003409568.1.29592 WP_003409568.1.29599 WP_003409568.1.29611 WP_003409568.1.29632 WP_003409568.1.29649 WP_003409568.1.2965 WP_003409568.1.29659 WP_003409568.1.2969 WP_003409568.1.29698 WP_003409568.1.29718 WP_003409568.1.29742 WP_003409568.1.29745 WP_003409568.1.29747 WP_003409568.1.29769 WP_003409568.1.29825 WP_003409568.1.29847 WP_003409568.1.29861 WP_003409568.1.29869 WP_003409568.1.29883 WP_003409568.1.29890 WP_003409568.1.299 WP_003409568.1.29931 WP_003409568.1.29960 WP_003409568.1.30014 WP_003409568.1.3004 WP_003409568.1.30040 WP_003409568.1.30043 WP_003409568.1.30074 WP_003409568.1.30097 WP_003409568.1.30101 WP_003409568.1.30106 WP_003409568.1.30114 WP_003409568.1.30126 WP_003409568.1.30131 WP_003409568.1.30138 WP_003409568.1.30139 WP_003409568.1.30145 WP_003409568.1.30211 WP_003409568.1.30224 WP_003409568.1.30235 WP_003409568.1.30237 WP_003409568.1.3027 WP_003409568.1.30279 WP_003409568.1.30282 WP_003409568.1.30283 WP_003409568.1.30288 WP_003409568.1.30291 WP_003409568.1.30363 WP_003409568.1.30374 WP_003409568.1.30404 WP_003409568.1.3043 WP_003409568.1.30433 WP_003409568.1.30438 WP_003409568.1.30462 WP_003409568.1.30468 WP_003409568.1.30500 WP_003409568.1.3057 WP_003409568.1.30574 WP_003409568.1.30628 WP_003409568.1.30641 WP_003409568.1.30642 WP_003409568.1.30661 WP_003409568.1.30669 WP_003409568.1.30683 WP_003409568.1.30699 WP_003409568.1.30709 WP_003409568.1.30713 WP_003409568.1.30716 WP_003409568.1.30719 WP_003409568.1.30730 WP_003409568.1.30732 WP_003409568.1.30736 WP_003409568.1.30745 WP_003409568.1.30760 WP_003409568.1.30791 WP_003409568.1.308 WP_003409568.1.30807 WP_003409568.1.30818 WP_003409568.1.30824 WP_003409568.1.30848 WP_003409568.1.30877 WP_003409568.1.30888 WP_003409568.1.30901 WP_003409568.1.30912 WP_003409568.1.30913 WP_003409568.1.30914 WP_003409568.1.30919 WP_003409568.1.30977 WP_003409568.1.3100 WP_003409568.1.31002 WP_003409568.1.31034 WP_003409568.1.31047 WP_003409568.1.31070 WP_003409568.1.31102 WP_003409568.1.31127 WP_003409568.1.31184 WP_003409568.1.31199 WP_003409568.1.31226 WP_003409568.1.31230 WP_003409568.1.31233 WP_003409568.1.31263 WP_003409568.1.31264 WP_003409568.1.31290 WP_003409568.1.31304 WP_003409568.1.31346 WP_003409568.1.31348 WP_003409568.1.31354 WP_003409568.1.31390 WP_003409568.1.31414 WP_003409568.1.31417 WP_003409568.1.31428 WP_003409568.1.3143 WP_003409568.1.31458 WP_003409568.1.31483 WP_003409568.1.3149 WP_003409568.1.31498 WP_003409568.1.31507 WP_003409568.1.31537 WP_003409568.1.31548 WP_003409568.1.31569 WP_003409568.1.31573 WP_003409568.1.316 WP_003409568.1.31629 WP_003409568.1.31666 WP_003409568.1.31693 WP_003409568.1.31703 WP_003409568.1.31744 WP_003409568.1.31770 WP_003409568.1.31776 WP_003409568.1.31783 WP_003409568.1.318 WP_003409568.1.3184 WP_003409568.1.31840 WP_003409568.1.31880 WP_003409568.1.31911 WP_003409568.1.31930 WP_003409568.1.31932 WP_003409568.1.31985 WP_003409568.1.31991 WP_003409568.1.31995 WP_003409568.1.32004 WP_003409568.1.32039 WP_003409568.1.3204 WP_003409568.1.32045 WP_003409568.1.32071 WP_003409568.1.32098 WP_003409568.1.32132 WP_003409568.1.32157 WP_003409568.1.32164 WP_003409568.1.32179 WP_003409568.1.32198 WP_003409568.1.32297 WP_003409568.1.32317 WP_003409568.1.32383 WP_003409568.1.32400 WP_003409568.1.32403 WP_003409568.1.32416 WP_003409568.1.32433 WP_003409568.1.32461 WP_003409568.1.32482 WP_003409568.1.32503 WP_003409568.1.32556 WP_003409568.1.32562 WP_003409568.1.32569 WP_003409568.1.32592 WP_003409568.1.32620 WP_003409568.1.32647 WP_003409568.1.32653 WP_003409568.1.32654 WP_003409568.1.3268 WP_003409568.1.32695 WP_003409568.1.32706 WP_003409568.1.32716 WP_003409568.1.32738 WP_003409568.1.32752 WP_003409568.1.32780 WP_003409568.1.32781 WP_003409568.1.32793 WP_003409568.1.32799 WP_003409568.1.32822 WP_003409568.1.32833 WP_003409568.1.32862 WP_003409568.1.32880 WP_003409568.1.32897 WP_003409568.1.32909 WP_003409568.1.32935 WP_003409568.1.32974 WP_003409568.1.33007 WP_003409568.1.3302 WP_003409568.1.33028 WP_003409568.1.33035 WP_003409568.1.33044 WP_003409568.1.33054 WP_003409568.1.33082 WP_003409568.1.33141 WP_003409568.1.33148 WP_003409568.1.33155 WP_003409568.1.33168 WP_003409568.1.3321 WP_003409568.1.33215 WP_003409568.1.3327 WP_003409568.1.33278 WP_003409568.1.33288 WP_003409568.1.33305 WP_003409568.1.3331 WP_003409568.1.33319 WP_003409568.1.3333 WP_003409568.1.33393 WP_003409568.1.33403 WP_003409568.1.33452 WP_003409568.1.33467 WP_003409568.1.33477 WP_003409568.1.3349 WP_003409568.1.33519 WP_003409568.1.33542 WP_003409568.1.33601 WP_003409568.1.33602 WP_003409568.1.33633 WP_003409568.1.33646 WP_003409568.1.33673 WP_003409568.1.3369 WP_003409568.1.33705 WP_003409568.1.33762 WP_003409568.1.33783 WP_003409568.1.33789 WP_003409568.1.3383 WP_003409568.1.33832 WP_003409568.1.33839 WP_003409568.1.3387 WP_003409568.1.33886 WP_003409568.1.33895 WP_003409568.1.33906 WP_003409568.1.33912 WP_003409568.1.33954 WP_003409568.1.3399 WP_003409568.1.34042 WP_003409568.1.3405 WP_003409568.1.34055 WP_003409568.1.34056 WP_003409568.1.34065 WP_003409568.1.3408 WP_003409568.1.34090 WP_003409568.1.34109 WP_003409568.1.34111 WP_003409568.1.34131 WP_003409568.1.34152 WP_003409568.1.34153 WP_003409568.1.34163 WP_003409568.1.34181 WP_003409568.1.34197 WP_003409568.1.34198 WP_003409568.1.34215 WP_003409568.1.34219 WP_003409568.1.34255 WP_003409568.1.34260 WP_003409568.1.34275 WP_003409568.1.343 WP_003409568.1.34347 WP_003409568.1.34358 WP_003409568.1.34392 WP_003409568.1.344 WP_003409568.1.34428 WP_003409568.1.3443 WP_003409568.1.34435 WP_003409568.1.34446 WP_003409568.1.34499 WP_003409568.1.34505 WP_003409568.1.34516 WP_003409568.1.34551 WP_003409568.1.34563 WP_003409568.1.34576 WP_003409568.1.34588 WP_003409568.1.34596 WP_003409568.1.34599 WP_003409568.1.34639 WP_003409568.1.34673 WP_003409568.1.34724 WP_003409568.1.34740 WP_003409568.1.34755 WP_003409568.1.34777 WP_003409568.1.34783 WP_003409568.1.34841 WP_003409568.1.34908 WP_003409568.1.34919 WP_003409568.1.3492 WP_003409568.1.34933 WP_003409568.1.34945 WP_003409568.1.34946 WP_003409568.1.34954 WP_003409568.1.34960 WP_003409568.1.34961 WP_003409568.1.34963 WP_003409568.1.34965 WP_003409568.1.34968 WP_003409568.1.35023 WP_003409568.1.35069 WP_003409568.1.35072 WP_003409568.1.35078 WP_003409568.1.35100 WP_003409568.1.35146 WP_003409568.1.35156 WP_003409568.1.35160 WP_003409568.1.35162 WP_003409568.1.35173 WP_003409568.1.35176 WP_003409568.1.3520 WP_003409568.1.35213 WP_003409568.1.35221 WP_003409568.1.35246 WP_003409568.1.35278 WP_003409568.1.35301 WP_003409568.1.35311 WP_003409568.1.35312 WP_003409568.1.35317 WP_003409568.1.35319 WP_003409568.1.35347 WP_003409568.1.35363 WP_003409568.1.35382 WP_003409568.1.35385 WP_003409568.1.35396 WP_003409568.1.35397 WP_003409568.1.35403 WP_003409568.1.35426 WP_003409568.1.35439 WP_003409568.1.3548 WP_003409568.1.35484 WP_003409568.1.35492 WP_003409568.1.35553 WP_003409568.1.35555 WP_003409568.1.35561 WP_003409568.1.35602 WP_003409568.1.35610 WP_003409568.1.35635 WP_003409568.1.35657 WP_003409568.1.35687 WP_003409568.1.35689 WP_003409568.1.35707 WP_003409568.1.35732 WP_003409568.1.35754 WP_003409568.1.35767 WP_003409568.1.35770 WP_003409568.1.35771 WP_003409568.1.35780 WP_003409568.1.35805 WP_003409568.1.35811 WP_003409568.1.35821 WP_003409568.1.3584 WP_003409568.1.35848 WP_003409568.1.35864 WP_003409568.1.35874 WP_003409568.1.35876 WP_003409568.1.35897 WP_003409568.1.35899 WP_003409568.1.35923 WP_003409568.1.3593 WP_003409568.1.35954 WP_003409568.1.36005 WP_003409568.1.36014 WP_003409568.1.36023 WP_003409568.1.36051 WP_003409568.1.36053 WP_003409568.1.36075 WP_003409568.1.36089 WP_003409568.1.36097 WP_003409568.1.36098 WP_003409568.1.36116 WP_003409568.1.36145 WP_003409568.1.36156 WP_003409568.1.36205 WP_003409568.1.36228 WP_003409568.1.36246 WP_003409568.1.36252 WP_003409568.1.36260 WP_003409568.1.36270 WP_003409568.1.36271 WP_003409568.1.36303 WP_003409568.1.36309 WP_003409568.1.36315 WP_003409568.1.36319 WP_003409568.1.36321 WP_003409568.1.3634 WP_003409568.1.36356 WP_003409568.1.36357 WP_003409568.1.3636 WP_003409568.1.36385 WP_003409568.1.36399 WP_003409568.1.36436 WP_003409568.1.36465 WP_003409568.1.36469 WP_003409568.1.36473 WP_003409568.1.36485 WP_003409568.1.36508 WP_003409568.1.36540 WP_003409568.1.36561 WP_003409568.1.36571 WP_003409568.1.36573 WP_003409568.1.36578 WP_003409568.1.36585 WP_003409568.1.36597 WP_003409568.1.36614 WP_003409568.1.36657 WP_003409568.1.36674 WP_003409568.1.36720 WP_003409568.1.36733 WP_003409568.1.36785 WP_003409568.1.36810 WP_003409568.1.36844 WP_003409568.1.36851 WP_003409568.1.36862 WP_003409568.1.36893 WP_003409568.1.36901 WP_003409568.1.36941 WP_003409568.1.3695 WP_003409568.1.36951 WP_003409568.1.36968 WP_003409568.1.3700 WP_003409568.1.37004 WP_003409568.1.37012 WP_003409568.1.37071 WP_003409568.1.37088 WP_003409568.1.37131 WP_003409568.1.37157 WP_003409568.1.37175 WP_003409568.1.37188 WP_003409568.1.37213 WP_003409568.1.37229 WP_003409568.1.3724 WP_003409568.1.37277 WP_003409568.1.37305 WP_003409568.1.37330 WP_003409568.1.37389 WP_003409568.1.37400 WP_003409568.1.37440 WP_003409568.1.37459 WP_003409568.1.37468 WP_003409568.1.37475 WP_003409568.1.37484 WP_003409568.1.37601 WP_003409568.1.37612 WP_003409568.1.37632 WP_003409568.1.37643 WP_003409568.1.37655 WP_003409568.1.37660 WP_003409568.1.37674 WP_003409568.1.37700 WP_003409568.1.37701 WP_003409568.1.37709 WP_003409568.1.37711 WP_003409568.1.37721 WP_003409568.1.37722 WP_003409568.1.37747 WP_003409568.1.37765 WP_003409568.1.37772 WP_003409568.1.37804 WP_003409568.1.37809 WP_003409568.1.37859 WP_003409568.1.37877 WP_003409568.1.37912 WP_003409568.1.37913 WP_003409568.1.37943 WP_003409568.1.37950 WP_003409568.1.37973 WP_003409568.1.37975 WP_003409568.1.37983 WP_003409568.1.38 WP_003409568.1.38002 WP_003409568.1.3802 WP_003409568.1.38039 WP_003409568.1.38040 WP_003409568.1.38067 WP_003409568.1.38068 WP_003409568.1.38135 WP_003409568.1.38138 WP_003409568.1.38144 WP_003409568.1.38158 WP_003409568.1.38159 WP_003409568.1.38210 WP_003409568.1.38233 WP_003409568.1.38240 WP_003409568.1.38299 WP_003409568.1.38332 WP_003409568.1.38347 WP_003409568.1.38354 WP_003409568.1.38380 WP_003409568.1.38384 WP_003409568.1.38389 WP_003409568.1.38398 WP_003409568.1.38402 WP_003409568.1.38418 WP_003409568.1.38421 WP_003409568.1.38466 WP_003409568.1.38477 WP_003409568.1.38483 WP_003409568.1.3849 WP_003409568.1.385 WP_003409568.1.38530 WP_003409568.1.38535 WP_003409568.1.38539 WP_003409568.1.38594 WP_003409568.1.38601 WP_003409568.1.38611 WP_003409568.1.38638 WP_003409568.1.38639 WP_003409568.1.38646 WP_003409568.1.38648 WP_003409568.1.38654 WP_003409568.1.38659 WP_003409568.1.38660 WP_003409568.1.38666 WP_003409568.1.38671 WP_003409568.1.38672 WP_003409568.1.38677 WP_003409568.1.38750 WP_003409568.1.38812 WP_003409568.1.38821 WP_003409568.1.38844 WP_003409568.1.38863 WP_003409568.1.38865 WP_003409568.1.38873 WP_003409568.1.3889 WP_003409568.1.38894 WP_003409568.1.38909 WP_003409568.1.38939 WP_003409568.1.38974 WP_003409568.1.38975 WP_003409568.1.38991 WP_003409568.1.39070 WP_003409568.1.39072 WP_003409568.1.39095 WP_003409568.1.39106 WP_003409568.1.39165 WP_003409568.1.39174 WP_003409568.1.39176 WP_003409568.1.39178 WP_003409568.1.39190 WP_003409568.1.39201 WP_003409568.1.39207 WP_003409568.1.39211 WP_003409568.1.39239 WP_003409568.1.39252 WP_003409568.1.39288 WP_003409568.1.39295 WP_003409568.1.39306 WP_003409568.1.39359 WP_003409568.1.39364 WP_003409568.1.39400 WP_003409568.1.39447 WP_003409568.1.3945 WP_003409568.1.39450 WP_003409568.1.39455 WP_003409568.1.3949 WP_003409568.1.39521 WP_003409568.1.39560 WP_003409568.1.39592 WP_003409568.1.39593 WP_003409568.1.3960 WP_003409568.1.39616 WP_003409568.1.39654 WP_003409568.1.39657 WP_003409568.1.39661 WP_003409568.1.39674 WP_003409568.1.39678 WP_003409568.1.3968 WP_003409568.1.39694 WP_003409568.1.3971 WP_003409568.1.39739 WP_003409568.1.39748 WP_003409568.1.39751 WP_003409568.1.39759 WP_003409568.1.39801 WP_003409568.1.39804 WP_003409568.1.39848 WP_003409568.1.39877 WP_003409568.1.39925 WP_003409568.1.3994 WP_003409568.1.39959 WP_003409568.1.3996 WP_003409568.1.39960 WP_003409568.1.3997 WP_003409568.1.39980 WP_003409568.1.40000 WP_003409568.1.40028 WP_003409568.1.40029 WP_003409568.1.4003 WP_003409568.1.40094 WP_003409568.1.40096 WP_003409568.1.40150 WP_003409568.1.40156 WP_003409568.1.40174 WP_003409568.1.40186 WP_003409568.1.40276 WP_003409568.1.40277 WP_003409568.1.40323 WP_003409568.1.40336 WP_003409568.1.40353 WP_003409568.1.4036 WP_003409568.1.40372 WP_003409568.1.40402 WP_003409568.1.40413 WP_003409568.1.40440 WP_003409568.1.40446 WP_003409568.1.40451 WP_003409568.1.40455 WP_003409568.1.40523 WP_003409568.1.40543 WP_003409568.1.40641 WP_003409568.1.40646 WP_003409568.1.40651 WP_003409568.1.40653 WP_003409568.1.4067 WP_003409568.1.40705 WP_003409568.1.40723 WP_003409568.1.40731 WP_003409568.1.40735 WP_003409568.1.40795 WP_003409568.1.40799 WP_003409568.1.40852 WP_003409568.1.40876 WP_003409568.1.40881 WP_003409568.1.40922 WP_003409568.1.40948 WP_003409568.1.4095 WP_003409568.1.40956 WP_003409568.1.40957 WP_003409568.1.40964 WP_003409568.1.4097 WP_003409568.1.410 WP_003409568.1.41000 WP_003409568.1.41055 WP_003409568.1.41123 WP_003409568.1.41177 WP_003409568.1.41202 WP_003409568.1.41219 WP_003409568.1.41231 WP_003409568.1.41249 WP_003409568.1.4127 WP_003409568.1.41296 WP_003409568.1.41355 WP_003409568.1.41376 WP_003409568.1.41430 WP_003409568.1.41447 WP_003409568.1.41469 WP_003409568.1.41504 WP_003409568.1.41564 WP_003409568.1.41583 WP_003409568.1.41616 WP_003409568.1.41632 WP_003409568.1.41635 WP_003409568.1.41636 WP_003409568.1.41648 WP_003409568.1.41660 WP_003409568.1.41685 WP_003409568.1.41695 WP_003409568.1.41704 WP_003409568.1.4171 WP_003409568.1.41719 WP_003409568.1.41733 WP_003409568.1.41744 WP_003409568.1.41774 WP_003409568.1.41791 WP_003409568.1.41803 WP_003409568.1.41820 WP_003409568.1.41828 WP_003409568.1.41829 WP_003409568.1.41860 WP_003409568.1.41912 WP_003409568.1.41921 WP_003409568.1.41933 WP_003409568.1.41944 WP_003409568.1.42043 WP_003409568.1.42075 WP_003409568.1.42078 WP_003409568.1.42094 WP_003409568.1.42112 WP_003409568.1.4212 WP_003409568.1.42122 WP_003409568.1.42134 WP_003409568.1.42183 WP_003409568.1.42188 WP_003409568.1.42201 WP_003409568.1.42202 WP_003409568.1.42208 WP_003409568.1.42247 WP_003409568.1.42255 WP_003409568.1.42273 WP_003409568.1.42278 WP_003409568.1.42304 WP_003409568.1.42309 WP_003409568.1.42370 WP_003409568.1.42385 WP_003409568.1.42400 WP_003409568.1.42409 WP_003409568.1.42414 WP_003409568.1.42417 WP_003409568.1.42430 WP_003409568.1.42465 WP_003409568.1.42473 WP_003409568.1.42474 WP_003409568.1.4248 WP_003409568.1.42494 WP_003409568.1.42519 WP_003409568.1.42524 WP_003409568.1.42534 WP_003409568.1.4255 WP_003409568.1.42562 WP_003409568.1.42568 WP_003409568.1.42570 WP_003409568.1.42618 WP_003409568.1.42660 WP_003409568.1.42695 WP_003409568.1.42704 WP_003409568.1.42705 WP_003409568.1.42722 WP_003409568.1.42777 WP_003409568.1.42782 WP_003409568.1.42835 WP_003409568.1.42839 WP_003409568.1.42842 WP_003409568.1.42916 WP_003409568.1.42930 WP_003409568.1.42971 WP_003409568.1.43005 WP_003409568.1.43009 WP_003409568.1.43053 WP_003409568.1.43082 WP_003409568.1.43087 WP_003409568.1.43098 WP_003409568.1.43208 WP_003409568.1.43236 WP_003409568.1.43246 WP_003409568.1.43255 WP_003409568.1.43266 WP_003409568.1.43269 WP_003409568.1.43273 WP_003409568.1.43296 WP_003409568.1.4335 WP_003409568.1.43368 WP_003409568.1.43395 WP_003409568.1.43457 WP_003409568.1.43462 WP_003409568.1.43475 WP_003409568.1.43478 WP_003409568.1.43484 WP_003409568.1.43557 WP_003409568.1.43578 WP_003409568.1.43588 WP_003409568.1.43643 WP_003409568.1.43664 WP_003409568.1.43684 WP_003409568.1.43686 WP_003409568.1.43706 WP_003409568.1.43716 WP_003409568.1.4377 WP_003409568.1.43781 WP_003409568.1.43794 WP_003409568.1.43815 WP_003409568.1.43846 WP_003409568.1.43861 WP_003409568.1.43863 WP_003409568.1.43866 WP_003409568.1.43872 WP_003409568.1.43885 WP_003409568.1.4390 WP_003409568.1.43902 WP_003409568.1.43921 WP_003409568.1.43936 WP_003409568.1.43937 WP_003409568.1.43960 WP_003409568.1.43965 WP_003409568.1.4399 WP_003409568.1.43993 WP_003409568.1.43996 WP_003409568.1.44 WP_003409568.1.44001 WP_003409568.1.44008 WP_003409568.1.44016 WP_003409568.1.44033 WP_003409568.1.44037 WP_003409568.1.44041 WP_003409568.1.44070 WP_003409568.1.44071 WP_003409568.1.44076 WP_003409568.1.44104 WP_003409568.1.44111 WP_003409568.1.44124 WP_003409568.1.44169 WP_003409568.1.44219 WP_003409568.1.44237 WP_003409568.1.44277 WP_003409568.1.44336 WP_003409568.1.44355 WP_003409568.1.44358 WP_003409568.1.4438 WP_003409568.1.44390 WP_003409568.1.44392 WP_003409568.1.4441 WP_003409568.1.44415 WP_003409568.1.44464 WP_003409568.1.44466 WP_003409568.1.44489 WP_003409568.1.44492 WP_003409568.1.44494 WP_003409568.1.44500 WP_003409568.1.44519 WP_003409568.1.44526 WP_003409568.1.44562 WP_003409568.1.44589 WP_003409568.1.44597 WP_003409568.1.44600 WP_003409568.1.44602 WP_003409568.1.44615 WP_003409568.1.4464 WP_003409568.1.44651 WP_003409568.1.44659 WP_003409568.1.44665 WP_003409568.1.44694 WP_003409568.1.44700 WP_003409568.1.44713 WP_003409568.1.44735 WP_003409568.1.44740 WP_003409568.1.44757 WP_003409568.1.4476 WP_003409568.1.44761 WP_003409568.1.44767 WP_003409568.1.44776 WP_003409568.1.44779 WP_003409568.1.44786 WP_003409568.1.44808 WP_003409568.1.44864 WP_003409568.1.44901 WP_003409568.1.44908 WP_003409568.1.44913 WP_003409568.1.4492 WP_003409568.1.44939 WP_003409568.1.44979 WP_003409568.1.44981 WP_003409568.1.45002 WP_003409568.1.4504 WP_003409568.1.45081 WP_003409568.1.45113 WP_003409568.1.45129 WP_003409568.1.45135 WP_003409568.1.45147 WP_003409568.1.45168 WP_003409568.1.4517 WP_003409568.1.45181 WP_003409568.1.45185 WP_003409568.1.45192 WP_003409568.1.45200 WP_003409568.1.45205 WP_003409568.1.45211 WP_003409568.1.45249 WP_003409568.1.45286 WP_003409568.1.45326 WP_003409568.1.45347 WP_003409568.1.45374 WP_003409568.1.45390 WP_003409568.1.454 WP_003409568.1.45407 WP_003409568.1.45451 WP_003409568.1.45460 WP_003409568.1.45463 WP_003409568.1.45470 WP_003409568.1.45474 WP_003409568.1.45491 WP_003409568.1.45510 WP_003409568.1.45563 WP_003409568.1.45584 WP_003409568.1.45590 WP_003409568.1.45619 WP_003409568.1.45626 WP_003409568.1.45631 WP_003409568.1.45666 WP_003409568.1.45697 WP_003409568.1.4571 WP_003409568.1.45731 WP_003409568.1.45743 WP_003409568.1.45765 WP_003409568.1.45776 WP_003409568.1.45783 WP_003409568.1.45849 WP_003409568.1.45867 WP_003409568.1.45884 WP_003409568.1.4590 WP_003409568.1.45923 WP_003409568.1.45926 WP_003409568.1.45963 WP_003409568.1.45989 WP_003409568.1.45992 WP_003409568.1.46025 WP_003409568.1.46083 WP_003409568.1.46090 WP_003409568.1.46100 WP_003409568.1.46101 WP_003409568.1.46103 WP_003409568.1.46107 WP_003409568.1.46127 WP_003409568.1.46128 WP_003409568.1.46129 WP_003409568.1.46141 WP_003409568.1.46150 WP_003409568.1.46201 WP_003409568.1.46226 WP_003409568.1.4624 WP_003409568.1.46253 WP_003409568.1.46268 WP_003409568.1.46285 WP_003409568.1.46300 WP_003409568.1.46313 WP_003409568.1.46336 WP_003409568.1.46365 WP_003409568.1.46370 WP_003409568.1.46381 WP_003409568.1.46402 WP_003409568.1.46411 WP_003409568.1.4644 WP_003409568.1.46442 WP_003409568.1.46453 WP_003409568.1.46463 WP_003409568.1.46478 WP_003409568.1.46492 WP_003409568.1.46521 WP_003409568.1.4653 WP_003409568.1.46532 WP_003409568.1.46539 WP_003409568.1.46568 WP_003409568.1.46585 WP_003409568.1.46609 WP_003409568.1.46613 WP_003409568.1.46625 WP_003409568.1.46647 WP_003409568.1.46674 WP_003409568.1.46724 WP_003409568.1.46758 WP_003409568.1.46773 WP_003409568.1.46777 WP_003409568.1.46786 WP_003409568.1.46792 WP_003409568.1.46847 WP_003409568.1.46851 WP_003409568.1.4687 WP_003409568.1.46897 WP_003409568.1.46936 WP_003409568.1.46980 WP_003409568.1.47011 WP_003409568.1.47012 WP_003409568.1.47066 WP_003409568.1.47077 WP_003409568.1.47083 WP_003409568.1.47106 WP_003409568.1.47142 WP_003409568.1.47147 WP_003409568.1.47166 WP_003409568.1.47178 WP_003409568.1.47179 WP_003409568.1.47194 WP_003409568.1.47207 WP_003409568.1.47210 WP_003409568.1.47261 WP_003409568.1.47262 WP_003409568.1.47402 WP_003409568.1.47423 WP_003409568.1.47467 WP_003409568.1.47502 WP_003409568.1.4751 WP_003409568.1.47511 WP_003409568.1.47540 WP_003409568.1.47568 WP_003409568.1.47572 WP_003409568.1.47588 WP_003409568.1.47636 WP_003409568.1.4764 WP_003409568.1.47653 WP_003409568.1.47679 WP_003409568.1.47681 WP_003409568.1.47690 WP_003409568.1.4771 WP_003409568.1.47717 WP_003409568.1.47743 WP_003409568.1.47754 WP_003409568.1.47773 WP_003409568.1.47776 WP_003409568.1.47780 WP_003409568.1.47805 WP_003409568.1.47832 WP_003409568.1.47847 WP_003409568.1.47858 WP_003409568.1.47861 WP_003409568.1.47868 WP_003409568.1.47893 WP_003409568.1.47899 WP_003409568.1.479 WP_003409568.1.47913 WP_003409568.1.47926 WP_003409568.1.4794 WP_003409568.1.47943 WP_003409568.1.47944 WP_003409568.1.47959 WP_003409568.1.47974 WP_003409568.1.47993 WP_003409568.1.48004 WP_003409568.1.48039 WP_003409568.1.48050 WP_003409568.1.48084 WP_003409568.1.48097 WP_003409568.1.48101 WP_003409568.1.48109 WP_003409568.1.4813 WP_003409568.1.48130 WP_003409568.1.48135 WP_003409568.1.48143 WP_003409568.1.48152 WP_003409568.1.48155 WP_003409568.1.48170 WP_003409568.1.48173 WP_003409568.1.48177 WP_003409568.1.48185 WP_003409568.1.48219 WP_003409568.1.4823 WP_003409568.1.48240 WP_003409568.1.48256 WP_003409568.1.48264 WP_003409568.1.48287 WP_003409568.1.48330 WP_003409568.1.48333 WP_003409568.1.48348 WP_003409568.1.48383 WP_003409568.1.48419 WP_003409568.1.48423 WP_003409568.1.48443 WP_003409568.1.48450 WP_003409568.1.48462 WP_003409568.1.48543 WP_003409568.1.48550 WP_003409568.1.48605 WP_003409568.1.48618 WP_003409568.1.4863 WP_003409568.1.48648 WP_003409568.1.48658 WP_003409568.1.48666 WP_003409568.1.48687 WP_003409568.1.48779 WP_003409568.1.4878 WP_003409568.1.48798 WP_003409568.1.48802 WP_003409568.1.48826 WP_003409568.1.48831 WP_003409568.1.48843 WP_003409568.1.4890 WP_003409568.1.48946 WP_003409568.1.48979 WP_003409568.1.49017 WP_003409568.1.49048 WP_003409568.1.49059 WP_003409568.1.4906 WP_003409568.1.4907 WP_003409568.1.49103 WP_003409568.1.49110 WP_003409568.1.49111 WP_003409568.1.49112 WP_003409568.1.4919 WP_003409568.1.49251 WP_003409568.1.49254 WP_003409568.1.49263 WP_003409568.1.49291 WP_003409568.1.49296 WP_003409568.1.49337 WP_003409568.1.49426 WP_003409568.1.49437 WP_003409568.1.49439 WP_003409568.1.49474 WP_003409568.1.49506 WP_003409568.1.49516 WP_003409568.1.49523 WP_003409568.1.49532 WP_003409568.1.49588 WP_003409568.1.4959 WP_003409568.1.49678 WP_003409568.1.49687 WP_003409568.1.49699 WP_003409568.1.49709 WP_003409568.1.4971 WP_003409568.1.4972 WP_003409568.1.49736 WP_003409568.1.49746 WP_003409568.1.49764 WP_003409568.1.49773 WP_003409568.1.49796 WP_003409568.1.49814 WP_003409568.1.49815 WP_003409568.1.49816 WP_003409568.1.49839 WP_003409568.1.49857 WP_003409568.1.49878 WP_003409568.1.49880 WP_003409568.1.49944 WP_003409568.1.4999 WP_003409568.1.49990 WP_003409568.1.50068 WP_003409568.1.50077 WP_003409568.1.5008 WP_003409568.1.50081 WP_003409568.1.50122 WP_003409568.1.50126 WP_003409568.1.50149 WP_003409568.1.50162 WP_003409568.1.5018 WP_003409568.1.50194 WP_003409568.1.50218 WP_003409568.1.50235 WP_003409568.1.50249 WP_003409568.1.50265 WP_003409568.1.50271 WP_003409568.1.50324 WP_003409568.1.50347 WP_003409568.1.50372 WP_003409568.1.50398 WP_003409568.1.50407 WP_003409568.1.50444 WP_003409568.1.50466 WP_003409568.1.50472 WP_003409568.1.5048 WP_003409568.1.50498 WP_003409568.1.50540 WP_003409568.1.50554 WP_003409568.1.50557 WP_003409568.1.50610 WP_003409568.1.50633 WP_003409568.1.50642 WP_003409568.1.50655 WP_003409568.1.50659 WP_003409568.1.50683 WP_003409568.1.50689 WP_003409568.1.50692 WP_003409568.1.50714 WP_003409568.1.50729 WP_003409568.1.50756 WP_003409568.1.50794 WP_003409568.1.50841 WP_003409568.1.50860 WP_003409568.1.50868 WP_003409568.1.50877 WP_003409568.1.5096 WP_003409568.1.50981 WP_003409568.1.50987 WP_003409568.1.51003 WP_003409568.1.51009 WP_003409568.1.51037 WP_003409568.1.51074 WP_003409568.1.51082 WP_003409568.1.51101 WP_003409568.1.51116 WP_003409568.1.51149 WP_003409568.1.51156 WP_003409568.1.51157 WP_003409568.1.51213 WP_003409568.1.51232 WP_003409568.1.51239 WP_003409568.1.51247 WP_003409568.1.51266 WP_003409568.1.51279 WP_003409568.1.51291 WP_003409568.1.51294 WP_003409568.1.51301 WP_003409568.1.51329 WP_003409568.1.51391 WP_003409568.1.51422 WP_003409568.1.51445 WP_003409568.1.51455 WP_003409568.1.51468 WP_003409568.1.51478 WP_003409568.1.51497 WP_003409568.1.51520 WP_003409568.1.51593 WP_003409568.1.51628 WP_003409568.1.5164 WP_003409568.1.51647 WP_003409568.1.51660 WP_003409568.1.51696 WP_003409568.1.51721 WP_003409568.1.51788 WP_003409568.1.51795 WP_003409568.1.51801 WP_003409568.1.51817 WP_003409568.1.51819 WP_003409568.1.51854 WP_003409568.1.51923 WP_003409568.1.51942 WP_003409568.1.51963 WP_003409568.1.51969 WP_003409568.1.52000 WP_003409568.1.52001 WP_003409568.1.52003 WP_003409568.1.52006 WP_003409568.1.52036 WP_003409568.1.52038 WP_003409568.1.52046 WP_003409568.1.52059 WP_003409568.1.52069 WP_003409568.1.52082 WP_003409568.1.52102 WP_003409568.1.52106 WP_003409568.1.52166 WP_003409568.1.52168 WP_003409568.1.52173 WP_003409568.1.52178 WP_003409568.1.52206 WP_003409568.1.52238 WP_003409568.1.52241 WP_003409568.1.52280 WP_003409568.1.52314 WP_003409568.1.52385 WP_003409568.1.52390 WP_003409568.1.52460 WP_003409568.1.52485 WP_003409568.1.52486 WP_003409568.1.52495 WP_003409568.1.52504 WP_003409568.1.52522 WP_003409568.1.52531 WP_003409568.1.52533 WP_003409568.1.52545 WP_003409568.1.52553 WP_003409568.1.52563 WP_003409568.1.52564 WP_003409568.1.52574 WP_003409568.1.52641 WP_003409568.1.52673 WP_003409568.1.52674 WP_003409568.1.52713 WP_003409568.1.52761 WP_003409568.1.52778 WP_003409568.1.52791 WP_003409568.1.52797 WP_003409568.1.52818 WP_003409568.1.52872 WP_003409568.1.52873 WP_003409568.1.52891 WP_003409568.1.52892 WP_003409568.1.52909 WP_003409568.1.52970 WP_003409568.1.52998 WP_003409568.1.53053 WP_003409568.1.53056 WP_003409568.1.5306 WP_003409568.1.53088 WP_003409568.1.5309 WP_003409568.1.531 WP_003409568.1.53117 WP_003409568.1.53118 WP_003409568.1.53143 WP_003409568.1.53157 WP_003409568.1.53167 WP_003409568.1.53200 WP_003409568.1.53204 WP_003409568.1.53213 WP_003409568.1.53217 WP_003409568.1.53226 WP_003409568.1.53229 WP_003409568.1.53230 WP_003409568.1.53237 WP_003409568.1.53254 WP_003409568.1.53257 WP_003409568.1.5327 WP_003409568.1.53276 WP_003409568.1.53278 WP_003409568.1.533 WP_003409568.1.53302 WP_003409568.1.53306 WP_003409568.1.5334 WP_003409568.1.5335 WP_003409568.1.53353 WP_003409568.1.53381 WP_003409568.1.53413 WP_003409568.1.53458 WP_003409568.1.53460 WP_003409568.1.53480 WP_003409568.1.53517 WP_003409568.1.53522 WP_003409568.1.53525 WP_003409568.1.53526 WP_003409568.1.53553 WP_003409568.1.53606 WP_003409568.1.53609 WP_003409568.1.53628 WP_003409568.1.53643 WP_003409568.1.53667 WP_003409568.1.53715 WP_003409568.1.53730 WP_003409568.1.53742 WP_003409568.1.53743 WP_003409568.1.53754 WP_003409568.1.53775 WP_003409568.1.53787 WP_003409568.1.53803 WP_003409568.1.53818 WP_003409568.1.53822 WP_003409568.1.53853 WP_003409568.1.53865 WP_003409568.1.53888 WP_003409568.1.53912 WP_003409568.1.53914 WP_003409568.1.53952 WP_003409568.1.5398 WP_003409568.1.5408 WP_003409568.1.54089 WP_003409568.1.54093 WP_003409568.1.54099 WP_003409568.1.54112 WP_003409568.1.54125 WP_003409568.1.54141 WP_003409568.1.54162 WP_003409568.1.54179 WP_003409568.1.54218 WP_003409568.1.54225 WP_003409568.1.54227 WP_003409568.1.54232 WP_003409568.1.54241 WP_003409568.1.54245 WP_003409568.1.54247 WP_003409568.1.54260 WP_003409568.1.54275 WP_003409568.1.54280 WP_003409568.1.5429 WP_003409568.1.54294 WP_003409568.1.54314 WP_003409568.1.54347 WP_003409568.1.54351 WP_003409568.1.54370 WP_003409568.1.54428 WP_003409568.1.54449 WP_003409568.1.54494 WP_003409568.1.54502 WP_003409568.1.54514 WP_003409568.1.54519 WP_003409568.1.5452 WP_003409568.1.54531 WP_003409568.1.54537 WP_003409568.1.54553 WP_003409568.1.54555 WP_003409568.1.54575 WP_003409568.1.54633 WP_003409568.1.54686 WP_003409568.1.54687 WP_003409568.1.54705 WP_003409568.1.54732 WP_003409568.1.5475 WP_003409568.1.54797 WP_003409568.1.54807 WP_003409568.1.54836 WP_003409568.1.54838 WP_003409568.1.54860 WP_003409568.1.54897 WP_003409568.1.54905 WP_003409568.1.54909 WP_003409568.1.54937 WP_003409568.1.54939 WP_003409568.1.54944 WP_003409568.1.54945 WP_003409568.1.54953 WP_003409568.1.54964 WP_003409568.1.55015 WP_003409568.1.55022 WP_003409568.1.55023 WP_003409568.1.55051 WP_003409568.1.55072 WP_003409568.1.55088 WP_003409568.1.55106 WP_003409568.1.55126 WP_003409568.1.55128 WP_003409568.1.55140 WP_003409568.1.55150 WP_003409568.1.55210 WP_003409568.1.55227 WP_003409568.1.55248 WP_003409568.1.55257 WP_003409568.1.55258 WP_003409568.1.55267 WP_003409568.1.55279 WP_003409568.1.55307 WP_003409568.1.55326 WP_003409568.1.5533 WP_003409568.1.55345 WP_003409568.1.55396 WP_003409568.1.55398 WP_003409568.1.55441 WP_003409568.1.55459 WP_003409568.1.55501 WP_003409568.1.55504 WP_003409568.1.55578 WP_003409568.1.55626 WP_003409568.1.55641 WP_003409568.1.5569 WP_003409568.1.55723 WP_003409568.1.55735 WP_003409568.1.5574 WP_003409568.1.55772 WP_003409568.1.55802 WP_003409568.1.55807 WP_003409568.1.55819 WP_003409568.1.55821 WP_003409568.1.5583 WP_003409568.1.55849 WP_003409568.1.55856 WP_003409568.1.55860 WP_003409568.1.55882 WP_003409568.1.55883 WP_003409568.1.55894 WP_003409568.1.55902 WP_003409568.1.55908 WP_003409568.1.55909 WP_003409568.1.5591 WP_003409568.1.55961 WP_003409568.1.55977 WP_003409568.1.55983 WP_003409568.1.56028 WP_003409568.1.56057 WP_003409568.1.56060 WP_003409568.1.56107 WP_003409568.1.56132 WP_003409568.1.56167 WP_003409568.1.56178 WP_003409568.1.56287 WP_003409568.1.56292 WP_003409568.1.56327 WP_003409568.1.56341 WP_003409568.1.56359 WP_003409568.1.56365 WP_003409568.1.56394 WP_003409568.1.56443 WP_003409568.1.56473 WP_003409568.1.56478 WP_003409568.1.56500 WP_003409568.1.56517 WP_003409568.1.56534 WP_003409568.1.5656 WP_003409568.1.56577 WP_003409568.1.56593 WP_003409568.1.56625 WP_003409568.1.56637 WP_003409568.1.56670 WP_003409568.1.56697 WP_003409568.1.567 WP_003409568.1.56701 WP_003409568.1.56709 WP_003409568.1.56729 WP_003409568.1.56743 WP_003409568.1.56764 WP_003409568.1.56769 WP_003409568.1.56795 WP_003409568.1.5681 WP_003409568.1.56827 WP_003409568.1.56839 WP_003409568.1.56863 WP_003409568.1.56868 WP_003409568.1.56869 WP_003409568.1.56915 WP_003409568.1.56926 WP_003409568.1.56961 WP_003409568.1.56971 WP_003409568.1.56972 WP_003409568.1.57023 WP_003409568.1.57035 WP_003409568.1.57077 WP_003409568.1.57087 WP_003409568.1.57094 WP_003409568.1.57134 WP_003409568.1.57151 WP_003409568.1.57169 WP_003409568.1.57208 WP_003409568.1.57212 WP_003409568.1.57230 WP_003409568.1.5724 WP_003409568.1.5725 WP_003409568.1.5727 WP_003409568.1.57273 WP_003409568.1.573 WP_003409568.1.57314 WP_003409568.1.57326 WP_003409568.1.57328 WP_003409568.1.57331 WP_003409568.1.57340 WP_003409568.1.57351 WP_003409568.1.57352 WP_003409568.1.57380 WP_003409568.1.57430 WP_003409568.1.5744 WP_003409568.1.57440 WP_003409568.1.5745 WP_003409568.1.57461 WP_003409568.1.57469 WP_003409568.1.57489 WP_003409568.1.575 WP_003409568.1.57509 WP_003409568.1.57519 WP_003409568.1.57525 WP_003409568.1.57551 WP_003409568.1.5758 WP_003409568.1.57596 WP_003409568.1.57604 WP_003409568.1.57616 WP_003409568.1.57617 WP_003409568.1.57619 WP_003409568.1.57627 WP_003409568.1.57642 WP_003409568.1.57658 WP_003409568.1.57667 WP_003409568.1.57675 WP_003409568.1.57689 WP_003409568.1.57708 WP_003409568.1.57794 WP_003409568.1.57821 WP_003409568.1.57825 WP_003409568.1.57843 WP_003409568.1.57906 WP_003409568.1.57924 WP_003409568.1.57926 WP_003409568.1.57930 WP_003409568.1.57957 WP_003409568.1.57960 WP_003409568.1.57964 WP_003409568.1.57991 WP_003409568.1.58000 WP_003409568.1.58101 WP_003409568.1.58108 WP_003409568.1.5811 WP_003409568.1.58121 WP_003409568.1.58145 WP_003409568.1.58164 WP_003409568.1.58174 WP_003409568.1.582 WP_003409568.1.58202 WP_003409568.1.58209 WP_003409568.1.58215 WP_003409568.1.5824 WP_003409568.1.58250 WP_003409568.1.58259 WP_003409568.1.58283 WP_003409568.1.58288 WP_003409568.1.5830 WP_003409568.1.58303 WP_003409568.1.58311 WP_003409568.1.58330 WP_003409568.1.58359 WP_003409568.1.58386 WP_003409568.1.58393 WP_003409568.1.58431 WP_003409568.1.5844 WP_003409568.1.58457 WP_003409568.1.58488 WP_003409568.1.58518 WP_003409568.1.58534 WP_003409568.1.58559 WP_003409568.1.58567 WP_003409568.1.58573 WP_003409568.1.58602 WP_003409568.1.58612 WP_003409568.1.58619 WP_003409568.1.5865 WP_003409568.1.58671 WP_003409568.1.58690 WP_003409568.1.58702 WP_003409568.1.58743 WP_003409568.1.58754 WP_003409568.1.5879 WP_003409568.1.5881 WP_003409568.1.58848 WP_003409568.1.58857 WP_003409568.1.58891 WP_003409568.1.58892 WP_003409568.1.5890 WP_003409568.1.58904 WP_003409568.1.58921 WP_003409568.1.58930 WP_003409568.1.58939 WP_003409568.1.58941 WP_003409568.1.58953 WP_003409568.1.58961 WP_003409568.1.5898 WP_003409568.1.59025 WP_003409568.1.59029 WP_003409568.1.59037 WP_003409568.1.59044 WP_003409568.1.59088 WP_003409568.1.59112 WP_003409568.1.59130 WP_003409568.1.5914 WP_003409568.1.59147 WP_003409568.1.59166 WP_003409568.1.59205 WP_003409568.1.59209 WP_003409568.1.59237 WP_003409568.1.59240 WP_003409568.1.59253 WP_003409568.1.59262 WP_003409568.1.59270 WP_003409568.1.5928 WP_003409568.1.59304 WP_003409568.1.59305 WP_003409568.1.59309 WP_003409568.1.59316 WP_003409568.1.59326 WP_003409568.1.59328 WP_003409568.1.59333 WP_003409568.1.59338 WP_003409568.1.59388 WP_003409568.1.59428 WP_003409568.1.59487 WP_003409568.1.59537 WP_003409568.1.59561 WP_003409568.1.59677 WP_003409568.1.59722 WP_003409568.1.59727 WP_003409568.1.59732 WP_003409568.1.59738 WP_003409568.1.59750 WP_003409568.1.59757 WP_003409568.1.59761 WP_003409568.1.59808 WP_003409568.1.59850 WP_003409568.1.59856 WP_003409568.1.59860 WP_003409568.1.59861 WP_003409568.1.5987 WP_003409568.1.59878 WP_003409568.1.59888 WP_003409568.1.59952 WP_003409568.1.5996 WP_003409568.1.59961 WP_003409568.1.59974 WP_003409568.1.6000 WP_003409568.1.60007 WP_003409568.1.60016 WP_003409568.1.6003 WP_003409568.1.60047 WP_003409568.1.6007 WP_003409568.1.60121 WP_003409568.1.60125 WP_003409568.1.60135 WP_003409568.1.60139 WP_003409568.1.60152 WP_003409568.1.60171 WP_003409568.1.60197 WP_003409568.1.6020 WP_003409568.1.60205 WP_003409568.1.60215 WP_003409568.1.60217 WP_003409568.1.60267 WP_003409568.1.60288 WP_003409568.1.60291 WP_003409568.1.60301 WP_003409568.1.60305 WP_003409568.1.60312 WP_003409568.1.60313 WP_003409568.1.60314 WP_003409568.1.60367 WP_003409568.1.60376 WP_003409568.1.60403 WP_003409568.1.60421 WP_003409568.1.60451 WP_003409568.1.60460 WP_003409568.1.60479 WP_003409568.1.60487 WP_003409568.1.60512 WP_003409568.1.60583 WP_003409568.1.60632 WP_003409568.1.60657 WP_003409568.1.60687 WP_003409568.1.60689 WP_003409568.1.60727 WP_003409568.1.60738 WP_003409568.1.60763 WP_003409568.1.6077 WP_003409568.1.60791 WP_003409568.1.60834 WP_003409568.1.60870 WP_003409568.1.60879 WP_003409568.1.60913 WP_003409568.1.60978 WP_003409568.1.61000 WP_003409568.1.61001 WP_003409568.1.61012 WP_003409568.1.61014 WP_003409568.1.61015 WP_003409568.1.61037 WP_003409568.1.61052 WP_003409568.1.61065 WP_003409568.1.61100 WP_003409568.1.61101 WP_003409568.1.61138 WP_003409568.1.61142 WP_003409568.1.61198 WP_003409568.1.612 WP_003409568.1.61234 WP_003409568.1.61256 WP_003409568.1.61314 WP_003409568.1.61321 WP_003409568.1.61326 WP_003409568.1.61328 WP_003409568.1.61368 WP_003409568.1.61391 WP_003409568.1.61409 WP_003409568.1.61420 WP_003409568.1.61422 WP_003409568.1.61425 WP_003409568.1.61428 WP_003409568.1.61469 WP_003409568.1.61494 WP_003409568.1.61522 WP_003409568.1.61552 WP_003409568.1.61557 WP_003409568.1.61567 WP_003409568.1.61571 WP_003409568.1.61573 WP_003409568.1.61584 WP_003409568.1.61586 WP_003409568.1.6159 WP_003409568.1.61592 WP_003409568.1.6160 WP_003409568.1.61614 WP_003409568.1.6163 WP_003409568.1.61655 WP_003409568.1.61665 WP_003409568.1.61669 WP_003409568.1.61682 WP_003409568.1.61692 WP_003409568.1.61719 WP_003409568.1.61728 WP_003409568.1.61750 WP_003409568.1.61754 WP_003409568.1.61755 WP_003409568.1.61757 WP_003409568.1.61778 WP_003409568.1.6179 WP_003409568.1.61793 WP_003409568.1.61816 WP_003409568.1.61842 WP_003409568.1.61850 WP_003409568.1.61862 WP_003409568.1.61865 WP_003409568.1.61868 WP_003409568.1.61911 WP_003409568.1.61925 WP_003409568.1.61941 WP_003409568.1.61953 WP_003409568.1.61979 WP_003409568.1.61986 WP_003409568.1.61987 WP_003409568.1.61998 WP_003409568.1.62021 WP_003409568.1.62087 WP_003409568.1.62089 WP_003409568.1.62101 WP_003409568.1.62104 WP_003409568.1.6211 WP_003409568.1.62225 WP_003409568.1.62230 WP_003409568.1.62238 WP_003409568.1.62249 WP_003409568.1.62270 WP_003409568.1.62281 WP_003409568.1.62307 WP_003409568.1.6231 WP_003409568.1.62360 WP_003409568.1.62371 WP_003409568.1.62379 WP_003409568.1.62395 WP_003409568.1.62408 WP_003409568.1.62449 WP_003409568.1.62468 WP_003409568.1.6248 WP_003409568.1.62508 WP_003409568.1.62565 WP_003409568.1.62594 WP_003409568.1.62606 WP_003409568.1.62616 WP_003409568.1.62666 WP_003409568.1.62687 WP_003409568.1.62715 WP_003409568.1.62730 WP_003409568.1.62738 WP_003409568.1.62761 WP_003409568.1.62766 WP_003409568.1.62786 WP_003409568.1.62813 WP_003409568.1.62839 WP_003409568.1.62841 WP_003409568.1.62909 WP_003409568.1.62936 WP_003409568.1.6294 WP_003409568.1.6295 WP_003409568.1.62962 WP_003409568.1.63007 WP_003409568.1.63032 WP_003409568.1.63037 WP_003409568.1.63064 WP_003409568.1.63066 WP_003409568.1.63072 WP_003409568.1.6308 WP_003409568.1.63081 WP_003409568.1.63096 WP_003409568.1.63106 WP_003409568.1.6314 WP_003409568.1.63144 WP_003409568.1.63154 WP_003409568.1.63160 WP_003409568.1.63161 WP_003409568.1.63166 WP_003409568.1.63175 WP_003409568.1.63194 WP_003409568.1.6322 WP_003409568.1.63222 WP_003409568.1.63247 WP_003409568.1.6328 WP_003409568.1.63291 WP_003409568.1.63312 WP_003409568.1.63317 WP_003409568.1.63331 WP_003409568.1.63373 WP_003409568.1.63384 WP_003409568.1.63403 WP_003409568.1.63424 WP_003409568.1.63428 WP_003409568.1.6345 WP_003409568.1.63464 WP_003409568.1.63502 WP_003409568.1.63504 WP_003409568.1.63522 WP_003409568.1.63530 WP_003409568.1.63538 WP_003409568.1.63564 WP_003409568.1.63567 WP_003409568.1.63596 WP_003409568.1.63600 WP_003409568.1.63623 WP_003409568.1.63624 WP_003409568.1.63625 WP_003409568.1.63627 WP_003409568.1.63654 WP_003409568.1.63662 WP_003409568.1.63711 WP_003409568.1.63734 WP_003409568.1.63807 WP_003409568.1.63819 WP_003409568.1.63844 WP_003409568.1.63888 WP_003409568.1.63913 WP_003409568.1.63915 WP_003409568.1.63918 WP_003409568.1.63961 WP_003409568.1.63970 WP_003409568.1.64000 WP_003409568.1.64027 WP_003409568.1.64058 WP_003409568.1.64065 WP_003409568.1.6407 WP_003409568.1.64082 WP_003409568.1.64091 WP_003409568.1.64102 WP_003409568.1.64104 WP_003409568.1.64119 WP_003409568.1.64169 WP_003409568.1.64219 WP_003409568.1.6422 WP_003409568.1.64222 WP_003409568.1.64223 WP_003409568.1.64228 WP_003409568.1.64249 WP_003409568.1.6427 WP_003409568.1.64278 WP_003409568.1.64287 WP_003409568.1.64414 WP_003409568.1.64419 WP_003409568.1.6443 WP_003409568.1.64463 WP_003409568.1.64480 WP_003409568.1.64497 WP_003409568.1.64506 WP_003409568.1.64511 WP_003409568.1.64513 WP_003409568.1.64514 WP_003409568.1.64515 WP_003409568.1.64522 WP_003409568.1.64526 WP_003409568.1.64543 WP_003409568.1.6456 WP_003409568.1.64567 WP_003409568.1.64588 WP_003409568.1.64589 WP_003409568.1.64594 WP_003409568.1.64595 WP_003409568.1.64608 WP_003409568.1.64619 WP_003409568.1.64629 WP_003409568.1.6464 WP_003409568.1.64664 WP_003409568.1.64669 WP_003409568.1.64672 WP_003409568.1.64680 WP_003409568.1.64682 WP_003409568.1.64727 WP_003409568.1.64729 WP_003409568.1.64774 WP_003409568.1.64776 WP_003409568.1.64802 WP_003409568.1.64832 WP_003409568.1.6486 WP_003409568.1.64870 WP_003409568.1.64898 WP_003409568.1.64922 WP_003409568.1.64924 WP_003409568.1.6493 WP_003409568.1.64937 WP_003409568.1.64941 WP_003409568.1.64966 WP_003409568.1.64973 WP_003409568.1.65001 WP_003409568.1.65026 WP_003409568.1.65053 WP_003409568.1.65070 WP_003409568.1.65079 WP_003409568.1.65102 WP_003409568.1.65157 WP_003409568.1.65181 WP_003409568.1.65212 WP_003409568.1.65229 WP_003409568.1.6523 WP_003409568.1.65253 WP_003409568.1.65289 WP_003409568.1.65315 WP_003409568.1.65329 WP_003409568.1.65359 WP_003409568.1.6536 WP_003409568.1.65374 WP_003409568.1.65386 WP_003409568.1.65414 WP_003409568.1.65416 WP_003409568.1.65433 WP_003409568.1.65455 WP_003409568.1.65467 WP_003409568.1.65488 WP_003409568.1.65529 WP_003409568.1.65539 WP_003409568.1.65583 WP_003409568.1.65612 WP_003409568.1.65623 WP_003409568.1.65635 WP_003409568.1.65637 WP_003409568.1.65648 WP_003409568.1.65683 WP_003409568.1.65686 WP_003409568.1.65707 WP_003409568.1.65733 WP_003409568.1.65746 WP_003409568.1.65747 WP_003409568.1.65759 WP_003409568.1.65816 WP_003409568.1.65858 WP_003409568.1.65862 WP_003409568.1.65893 WP_003409568.1.65929 WP_003409568.1.65958 WP_003409568.1.65974 WP_003409568.1.66004 WP_003409568.1.66013 WP_003409568.1.6606 WP_003409568.1.66089 WP_003409568.1.66149 WP_003409568.1.66151 WP_003409568.1.66229 WP_003409568.1.66276 WP_003409568.1.66293 WP_003409568.1.66297 WP_003409568.1.66323 WP_003409568.1.66325 WP_003409568.1.6633 WP_003409568.1.66334 WP_003409568.1.66355 WP_003409568.1.66367 WP_003409568.1.66394 WP_003409568.1.66396 WP_003409568.1.66451 WP_003409568.1.66455 WP_003409568.1.66457 WP_003409568.1.66460 WP_003409568.1.66464 WP_003409568.1.66466 WP_003409568.1.66487 WP_003409568.1.66504 WP_003409568.1.66544 WP_003409568.1.66580 WP_003409568.1.66582 WP_003409568.1.66612 WP_003409568.1.66615 WP_003409568.1.66617 WP_003409568.1.66635 WP_003409568.1.66656 WP_003409568.1.66663 WP_003409568.1.66675 WP_003409568.1.66715 WP_003409568.1.66718 WP_003409568.1.66762 WP_003409568.1.66776 WP_003409568.1.66808 WP_003409568.1.66817 WP_003409568.1.66819 WP_003409568.1.66826 WP_003409568.1.66830 WP_003409568.1.66842 WP_003409568.1.66880 WP_003409568.1.66893 WP_003409568.1.66961 WP_003409568.1.67005 WP_003409568.1.6704 WP_003409568.1.67044 WP_003409568.1.67061 WP_003409568.1.67089 WP_003409568.1.67098 WP_003409568.1.67146 WP_003409568.1.67170 WP_003409568.1.67198 WP_003409568.1.6720 WP_003409568.1.67207 WP_003409568.1.67218 WP_003409568.1.67220 WP_003409568.1.67225 WP_003409568.1.67231 WP_003409568.1.6724 WP_003409568.1.67257 WP_003409568.1.67298 WP_003409568.1.67324 WP_003409568.1.67332 WP_003409568.1.67346 WP_003409568.1.67354 WP_003409568.1.67360 WP_003409568.1.67381 WP_003409568.1.67396 WP_003409568.1.67417 WP_003409568.1.67422 WP_003409568.1.67453 WP_003409568.1.67459 WP_003409568.1.6746 WP_003409568.1.67473 WP_003409568.1.67481 WP_003409568.1.67496 WP_003409568.1.67499 WP_003409568.1.67516 WP_003409568.1.67523 WP_003409568.1.67536 WP_003409568.1.67575 WP_003409568.1.67587 WP_003409568.1.67598 WP_003409568.1.67600 WP_003409568.1.67602 WP_003409568.1.67630 WP_003409568.1.67679 WP_003409568.1.67692 WP_003409568.1.67744 WP_003409568.1.6775 WP_003409568.1.67750 WP_003409568.1.6777 WP_003409568.1.67809 WP_003409568.1.67816 WP_003409568.1.67844 WP_003409568.1.67848 WP_003409568.1.67870 WP_003409568.1.67888 WP_003409568.1.67915 WP_003409568.1.67945 WP_003409568.1.67949 WP_003409568.1.67980 WP_003409568.1.67982 WP_003409568.1.68022 WP_003409568.1.68029 WP_003409568.1.68037 WP_003409568.1.68038 WP_003409568.1.68045 WP_003409568.1.68057 WP_003409568.1.68083 WP_003409568.1.68088 WP_003409568.1.68106 WP_003409568.1.68110 WP_003409568.1.68153 WP_003409568.1.68164 WP_003409568.1.68169 WP_003409568.1.68193 WP_003409568.1.68212 WP_003409568.1.68227 WP_003409568.1.68243 WP_003409568.1.6825 WP_003409568.1.68297 WP_003409568.1.68309 WP_003409568.1.68325 WP_003409568.1.68329 WP_003409568.1.68340 WP_003409568.1.68384 WP_003409568.1.68388 WP_003409568.1.68429 WP_003409568.1.6843 WP_003409568.1.68433 WP_003409568.1.68444 WP_003409568.1.68465 WP_003409568.1.68484 WP_003409568.1.68518 WP_003409568.1.68569 WP_003409568.1.68576 WP_003409568.1.68580 WP_003409568.1.68586 WP_003409568.1.68623 WP_003409568.1.68624 WP_003409568.1.68637 WP_003409568.1.68646 WP_003409568.1.68667 WP_003409568.1.68672 WP_003409568.1.68684 WP_003409568.1.68704 WP_003409568.1.68708 WP_003409568.1.6872 WP_003409568.1.68730 WP_003409568.1.68734 WP_003409568.1.68748 WP_003409568.1.68754 WP_003409568.1.6876 WP_003409568.1.68761 WP_003409568.1.68763 WP_003409568.1.68766 WP_003409568.1.68774 WP_003409568.1.68796 WP_003409568.1.68824 WP_003409568.1.68832 WP_003409568.1.68833 WP_003409568.1.68841 WP_003409568.1.68859 WP_003409568.1.68876 WP_003409568.1.68906 WP_003409568.1.68916 WP_003409568.1.68923 WP_003409568.1.68945 WP_003409568.1.6896 WP_003409568.1.68981 WP_003409568.1.68984 WP_003409568.1.69008 WP_003409568.1.69076 WP_003409568.1.69079 WP_003409568.1.6908 WP_003409568.1.69082 WP_003409568.1.69178 WP_003409568.1.69181 WP_003409568.1.69208 WP_003409568.1.69231 WP_003409568.1.69256 WP_003409568.1.69311 WP_003409568.1.69315 WP_003409568.1.69322 WP_003409568.1.69342 WP_003409568.1.6935 WP_003409568.1.6936 WP_003409568.1.69369 WP_003409568.1.69374 WP_003409568.1.69398 WP_003409568.1.69401 WP_003409568.1.69426 WP_003409568.1.69427 WP_003409568.1.6949 WP_003409568.1.6951 WP_003409568.1.69511 WP_003409568.1.69526 WP_003409568.1.69528 WP_003409568.1.69547 WP_003409568.1.69573 WP_003409568.1.69581 WP_003409568.1.6960 WP_003409568.1.69617 WP_003409568.1.69634 WP_003409568.1.69647 WP_003409568.1.69659 WP_003409568.1.69673 WP_003409568.1.69682 WP_003409568.1.69684 WP_003409568.1.69686 WP_003409568.1.69707 WP_003409568.1.69709 WP_003409568.1.69723 WP_003409568.1.69736 WP_003409568.1.69778 WP_003409568.1.69800 WP_003409568.1.69802 WP_003409568.1.69845 WP_003409568.1.69870 WP_003409568.1.69873 WP_003409568.1.69898 WP_003409568.1.69913 WP_003409568.1.69925 WP_003409568.1.69931 WP_003409568.1.69938 WP_003409568.1.69955 WP_003409568.1.69957 WP_003409568.1.69981 WP_003409568.1.69990 WP_003409568.1.70000 WP_003409568.1.70017 WP_003409568.1.70032 WP_003409568.1.70055 WP_003409568.1.70062 WP_003409568.1.70072 WP_003409568.1.70131 WP_003409568.1.70132 WP_003409568.1.7022 WP_003409568.1.70227 WP_003409568.1.70255 WP_003409568.1.70271 WP_003409568.1.70274 WP_003409568.1.7029 WP_003409568.1.70325 WP_003409568.1.70328 WP_003409568.1.70356 WP_003409568.1.70364 WP_003409568.1.70368 WP_003409568.1.70369 WP_003409568.1.70418 WP_003409568.1.70422 WP_003409568.1.70435 WP_003409568.1.70444 WP_003409568.1.70463 WP_003409568.1.70471 WP_003409568.1.70480 WP_003409568.1.70494 WP_003409568.1.70498 WP_003409568.1.70505 WP_003409568.1.70525 WP_003409568.1.70573 WP_003409568.1.70577 WP_003409568.1.70610 WP_003409568.1.70615 WP_003409568.1.70618 WP_003409568.1.70622 WP_003409568.1.70626 WP_003409568.1.70668 WP_003409568.1.70699 WP_003409568.1.70704 WP_003409568.1.70729 WP_003409568.1.70757 WP_003409568.1.70782 WP_003409568.1.70796 WP_003409568.1.70834 WP_003409568.1.7084 WP_003409568.1.70840 WP_003409568.1.70864 WP_003409568.1.70871 WP_003409568.1.70915 WP_003409568.1.70955 WP_003409568.1.70958 WP_003409568.1.70964 WP_003409568.1.70976 WP_003409568.1.71015 WP_003409568.1.71026 WP_003409568.1.71063 WP_003409568.1.71076 WP_003409568.1.71083 WP_003409568.1.7111 WP_003409568.1.71118 WP_003409568.1.71128 WP_003409568.1.7113 WP_003409568.1.71187 WP_003409568.1.71191 WP_003409568.1.71255 WP_003409568.1.71258 WP_003409568.1.71259 WP_003409568.1.71289 WP_003409568.1.71326 WP_003409568.1.71329 WP_003409568.1.71331 WP_003409568.1.71344 WP_003409568.1.71390 WP_003409568.1.71414 WP_003409568.1.71440 WP_003409568.1.71457 WP_003409568.1.7146 WP_003409568.1.71464 WP_003409568.1.71490 WP_003409568.1.71492 WP_003409568.1.71509 WP_003409568.1.71516 WP_003409568.1.71517 WP_003409568.1.71527 WP_003409568.1.71532 WP_003409568.1.71545 WP_003409568.1.71546 WP_003409568.1.71569 WP_003409568.1.71604 WP_003409568.1.71621 WP_003409568.1.71630 WP_003409568.1.71638 WP_003409568.1.71654 WP_003409568.1.71664 WP_003409568.1.71683 WP_003409568.1.71701 WP_003409568.1.71718 WP_003409568.1.71731 WP_003409568.1.71778 WP_003409568.1.71781 WP_003409568.1.71803 WP_003409568.1.71820 WP_003409568.1.71847 WP_003409568.1.7185 WP_003409568.1.71851 WP_003409568.1.71871 WP_003409568.1.71909 WP_003409568.1.71957 WP_003409568.1.71970 WP_003409568.1.72047 WP_003409568.1.72061 WP_003409568.1.72062 WP_003409568.1.72072 WP_003409568.1.72111 WP_003409568.1.72122 WP_003409568.1.72128 WP_003409568.1.72143 WP_003409568.1.7216 WP_003409568.1.72179 WP_003409568.1.72209 WP_003409568.1.72218 WP_003409568.1.72219 WP_003409568.1.72227 WP_003409568.1.7224 WP_003409568.1.72268 WP_003409568.1.72332 WP_003409568.1.72380 WP_003409568.1.72405 WP_003409568.1.72420 WP_003409568.1.72441 WP_003409568.1.72451 WP_003409568.1.72452 WP_003409568.1.72457 WP_003409568.1.72459 WP_003409568.1.72460 WP_003409568.1.72466 WP_003409568.1.72487 WP_003409568.1.72492 WP_003409568.1.72506 WP_003409568.1.72543 WP_003409568.1.7256 WP_003409568.1.72576 WP_003409568.1.72578 WP_003409568.1.72585 WP_003409568.1.72591 WP_003409568.1.72592 WP_003409568.1.72640 WP_003409568.1.7266 WP_003409568.1.72661 WP_003409568.1.72684 WP_003409568.1.72739 WP_003409568.1.72744 WP_003409568.1.72755 WP_003409568.1.72759 WP_003409568.1.72784 WP_003409568.1.72792 WP_003409568.1.72826 WP_003409568.1.72831 WP_003409568.1.72852 WP_003409568.1.72853 WP_003409568.1.72879 WP_003409568.1.72880 WP_003409568.1.72938 WP_003409568.1.72954 WP_003409568.1.72957 WP_003409568.1.72959 WP_003409568.1.72973 WP_003409568.1.7298 WP_003409568.1.72982 WP_003409568.1.72988 WP_003409568.1.72993 WP_003409568.1.73006 WP_003409568.1.73013 WP_003409568.1.73025 WP_003409568.1.73028 WP_003409568.1.73042 WP_003409568.1.73045 WP_003409568.1.73092 WP_003409568.1.73118 WP_003409568.1.7312 WP_003409568.1.73127 WP_003409568.1.73134 WP_003409568.1.73150 WP_003409568.1.73154 WP_003409568.1.73163 WP_003409568.1.73182 WP_003409568.1.73205 WP_003409568.1.7321 WP_003409568.1.73310 WP_003409568.1.73315 WP_003409568.1.73365 WP_003409568.1.73391 WP_003409568.1.73404 WP_003409568.1.73424 WP_003409568.1.73436 WP_003409568.1.73445 WP_003409568.1.73453 WP_003409568.1.73465 WP_003409568.1.73466 WP_003409568.1.73470 WP_003409568.1.73471 WP_003409568.1.73478 WP_003409568.1.73482 WP_003409568.1.73507 WP_003409568.1.73532 WP_003409568.1.73550 WP_003409568.1.73564 WP_003409568.1.73623 WP_003409568.1.73629 WP_003409568.1.73644 WP_003409568.1.7366 WP_003409568.1.73661 WP_003409568.1.7368 WP_003409568.1.73688 WP_003409568.1.73723 WP_003409568.1.73750 WP_003409568.1.73760 WP_003409568.1.73774 WP_003409568.1.7379 WP_003409568.1.73813 WP_003409568.1.73840 WP_003409568.1.73876 WP_003409568.1.7389 WP_003409568.1.73986 WP_003409568.1.74039 WP_003409568.1.74083 WP_003409568.1.74101 WP_003409568.1.74107 WP_003409568.1.74120 WP_003409568.1.74129 WP_003409568.1.74144 WP_003409568.1.7417 WP_003409568.1.74190 WP_003409568.1.74210 WP_003409568.1.7423 WP_003409568.1.74259 WP_003409568.1.74262 WP_003409568.1.74269 WP_003409568.1.74282 WP_003409568.1.74291 WP_003409568.1.74296 WP_003409568.1.74304 WP_003409568.1.7432 WP_003409568.1.74347 WP_003409568.1.7436 WP_003409568.1.74378 WP_003409568.1.74382 WP_003409568.1.74395 WP_003409568.1.74400 WP_003409568.1.74401 WP_003409568.1.74432 WP_003409568.1.74442 WP_003409568.1.74477 WP_003409568.1.74499 WP_003409568.1.74504 WP_003409568.1.74511 WP_003409568.1.74523 WP_003409568.1.74525 WP_003409568.1.74551 WP_003409568.1.74555 WP_003409568.1.74628 WP_003409568.1.74641 WP_003409568.1.74653 WP_003409568.1.74660 WP_003409568.1.74683 WP_003409568.1.7469 WP_003409568.1.74760 WP_003409568.1.74786 WP_003409568.1.74809 WP_003409568.1.74820 WP_003409568.1.74870 WP_003409568.1.74881 WP_003409568.1.74888 WP_003409568.1.74952 WP_003409568.1.7496 WP_003409568.1.74988 WP_003409568.1.75043 WP_003409568.1.75045 WP_003409568.1.75055 WP_003409568.1.75078 WP_003409568.1.75081 WP_003409568.1.75120 WP_003409568.1.75163 WP_003409568.1.75188 WP_003409568.1.75200 WP_003409568.1.75202 WP_003409568.1.75234 WP_003409568.1.75239 WP_003409568.1.75250 WP_003409568.1.75263 WP_003409568.1.75281 WP_003409568.1.75342 WP_003409568.1.7535 WP_003409568.1.75376 WP_003409568.1.75391 WP_003409568.1.75395 WP_003409568.1.75441 WP_003409568.1.75510 WP_003409568.1.75581 WP_003409568.1.75598 WP_003409568.1.75645 WP_003409568.1.75665 WP_003409568.1.75671 WP_003409568.1.75741 WP_003409568.1.75749 WP_003409568.1.75772 WP_003409568.1.75774 WP_003409568.1.75811 WP_003409568.1.75833 WP_003409568.1.7585 WP_003409568.1.75864 WP_003409568.1.75868 WP_003409568.1.75878 WP_003409568.1.75927 WP_003409568.1.75946 WP_003409568.1.75968 WP_003409568.1.75974 WP_003409568.1.76007 WP_003409568.1.76016 WP_003409568.1.76032 WP_003409568.1.76037 WP_003409568.1.7604 WP_003409568.1.76045 WP_003409568.1.76052 WP_003409568.1.76058 WP_003409568.1.76064 WP_003409568.1.76110 WP_003409568.1.76126 WP_003409568.1.76133 WP_003409568.1.76138 WP_003409568.1.76157 WP_003409568.1.76172 WP_003409568.1.76177 WP_003409568.1.76183 WP_003409568.1.76209 WP_003409568.1.76239 WP_003409568.1.76272 WP_003409568.1.76277 WP_003409568.1.76280 WP_003409568.1.76281 WP_003409568.1.76291 WP_003409568.1.76297 WP_003409568.1.76360 WP_003409568.1.76379 WP_003409568.1.76403 WP_003409568.1.76413 WP_003409568.1.76414 WP_003409568.1.76427 WP_003409568.1.76442 WP_003409568.1.76443 WP_003409568.1.76456 WP_003409568.1.76521 WP_003409568.1.76533 WP_003409568.1.76616 WP_003409568.1.76625 WP_003409568.1.76629 WP_003409568.1.76635 WP_003409568.1.76638 WP_003409568.1.76639 WP_003409568.1.76640 WP_003409568.1.76644 WP_003409568.1.76677 WP_003409568.1.76678 WP_003409568.1.76679 WP_003409568.1.76734 WP_003409568.1.76744 WP_003409568.1.76750 WP_003409568.1.76754 WP_003409568.1.76781 WP_003409568.1.76818 WP_003409568.1.76824 WP_003409568.1.76835 WP_003409568.1.76873 WP_003409568.1.76881 WP_003409568.1.76888 WP_003409568.1.76900 WP_003409568.1.7691 WP_003409568.1.76947 WP_003409568.1.76954 WP_003409568.1.76955 WP_003409568.1.76963 WP_003409568.1.76976 WP_003409568.1.770 WP_003409568.1.77000 WP_003409568.1.77008 WP_003409568.1.77021 WP_003409568.1.77056 WP_003409568.1.77065 WP_003409568.1.77075 WP_003409568.1.77093 WP_003409568.1.77107 WP_003409568.1.77115 WP_003409568.1.77118 WP_003409568.1.77125 WP_003409568.1.77141 WP_003409568.1.77142 WP_003409568.1.77166 WP_003409568.1.77250 WP_003409568.1.77252 WP_003409568.1.77260 WP_003409568.1.77266 WP_003409568.1.77280 WP_003409568.1.77285 WP_003409568.1.77312 WP_003409568.1.77348 WP_003409568.1.77351 WP_003409568.1.77352 WP_003409568.1.77361 WP_003409568.1.774 WP_003409568.1.7740 WP_003409568.1.77404 WP_003409568.1.77425 WP_003409568.1.77463 WP_003409568.1.77474 WP_003409568.1.7748 WP_003409568.1.77484 WP_003409568.1.77491 WP_003409568.1.77499 WP_003409568.1.77510 WP_003409568.1.77530 WP_003409568.1.77554 WP_003409568.1.77559 WP_003409568.1.77599 WP_003409568.1.77605 WP_003409568.1.7762 WP_003409568.1.77627 WP_003409568.1.77649 WP_003409568.1.77654 WP_003409568.1.7766 WP_003409568.1.77667 WP_003409568.1.77704 WP_003409568.1.77706 WP_003409568.1.77726 WP_003409568.1.77774 WP_003409568.1.7778 WP_003409568.1.77790 WP_003409568.1.77809 WP_003409568.1.77820 WP_003409568.1.77843 WP_003409568.1.77855 WP_003409568.1.77865 WP_003409568.1.77868 WP_003409568.1.77879 WP_003409568.1.77890 WP_003409568.1.77909 WP_003409568.1.77911 WP_003409568.1.77931 WP_003409568.1.77984 WP_003409568.1.78020 WP_003409568.1.78024 WP_003409568.1.78075 WP_003409568.1.78084 WP_003409568.1.78086 WP_003409568.1.7809 WP_003409568.1.78098 WP_003409568.1.78113 WP_003409568.1.78136 WP_003409568.1.78162 WP_003409568.1.7817 WP_003409568.1.78200 WP_003409568.1.78216 WP_003409568.1.78236 WP_003409568.1.78238 WP_003409568.1.78322 WP_003409568.1.78338 WP_003409568.1.7836 WP_003409568.1.78360 WP_003409568.1.78386 WP_003409568.1.78429 WP_003409568.1.78435 WP_003409568.1.7844 WP_003409568.1.78459 WP_003409568.1.78488 WP_003409568.1.7849 WP_003409568.1.78499 WP_003409568.1.785 WP_003409568.1.78516 WP_003409568.1.78524 WP_003409568.1.78526 WP_003409568.1.78538 WP_003409568.1.78544 WP_003409568.1.78545 WP_003409568.1.78547 WP_003409568.1.78574 WP_003409568.1.78580 WP_003409568.1.7860 WP_003409568.1.78620 WP_003409568.1.78646 WP_003409568.1.78648 WP_003409568.1.78649 WP_003409568.1.78655 WP_003409568.1.78657 WP_003409568.1.78659 WP_003409568.1.7869 WP_003409568.1.78692 WP_003409568.1.78760 WP_003409568.1.78766 WP_003409568.1.78776 WP_003409568.1.78778 WP_003409568.1.78784 WP_003409568.1.78788 WP_003409568.1.78790 WP_003409568.1.78793 WP_003409568.1.78848 WP_003409568.1.78860 WP_003409568.1.7887 WP_003409568.1.78884 WP_003409568.1.78932 WP_003409568.1.78969 WP_003409568.1.78977 WP_003409568.1.78980 WP_003409568.1.79005 WP_003409568.1.79016 WP_003409568.1.79033 WP_003409568.1.79064 WP_003409568.1.79066 WP_003409568.1.79068 WP_003409568.1.79077 WP_003409568.1.79095 WP_003409568.1.79112 WP_003409568.1.79122 WP_003409568.1.79145 WP_003409568.1.79152 WP_003409568.1.79163 WP_003409568.1.79182 WP_003409568.1.79198 WP_003409568.1.79213 WP_003409568.1.79218 WP_003409568.1.79268 WP_003409568.1.79273 WP_003409568.1.79278 WP_003409568.1.79290 WP_003409568.1.79319 WP_003409568.1.79325 WP_003409568.1.79326 WP_003409568.1.7933 WP_003409568.1.79330 WP_003409568.1.79339 WP_003409568.1.79394 WP_003409568.1.79399 WP_003409568.1.79413 WP_003409568.1.79422 WP_003409568.1.79445 WP_003409568.1.79447 WP_003409568.1.79455 WP_003409568.1.79471 WP_003409568.1.79480 WP_003409568.1.79482 WP_003409568.1.79488 WP_003409568.1.79500 WP_003409568.1.79502 WP_003409568.1.79508 WP_003409568.1.79561 WP_003409568.1.79565 WP_003409568.1.79578 WP_003409568.1.79588 WP_003409568.1.79598 WP_003409568.1.79615 WP_003409568.1.79684 WP_003409568.1.79698 WP_003409568.1.797 WP_003409568.1.79744 WP_003409568.1.79784 WP_003409568.1.79802 WP_003409568.1.79806 WP_003409568.1.79819 WP_003409568.1.79826 WP_003409568.1.79828 WP_003409568.1.79851 WP_003409568.1.79853 WP_003409568.1.79863 WP_003409568.1.79881 WP_003409568.1.79885 WP_003409568.1.79898 WP_003409568.1.7990 WP_003409568.1.79900 WP_003409568.1.79913 WP_003409568.1.79918 WP_003409568.1.79947 WP_003409568.1.79948 WP_003409568.1.7995 WP_003409568.1.7997 WP_003409568.1.80004 WP_003409568.1.80015 WP_003409568.1.80022 WP_003409568.1.80030 WP_003409568.1.80054 WP_003409568.1.80084 WP_003409568.1.80129 WP_003409568.1.80234 WP_003409568.1.8026 WP_003409568.1.80275 WP_003409568.1.8029 WP_003409568.1.80299 WP_003409568.1.80300 WP_003409568.1.80304 WP_003409568.1.80326 WP_003409568.1.80351 WP_003409568.1.8037 WP_003409568.1.80370 WP_003409568.1.80387 WP_003409568.1.80399 WP_003409568.1.8044 WP_003409568.1.80451 WP_003409568.1.80458 WP_003409568.1.80461 WP_003409568.1.80490 WP_003409568.1.80503 WP_003409568.1.80507 WP_003409568.1.80552 WP_003409568.1.80576 WP_003409568.1.80588 WP_003409568.1.80599 WP_003409568.1.8060 WP_003409568.1.80624 WP_003409568.1.80636 WP_003409568.1.80673 WP_003409568.1.80711 WP_003409568.1.80714 WP_003409568.1.80743 WP_003409568.1.80784 WP_003409568.1.80815 WP_003409568.1.80853 WP_003409568.1.80918 WP_003409568.1.8093 WP_003409568.1.80967 WP_003409568.1.8097 WP_003409568.1.80988 WP_003409568.1.81007 WP_003409568.1.81013 WP_003409568.1.8105 WP_003409568.1.81059 WP_003409568.1.81063 WP_003409568.1.81066 WP_003409568.1.81075 WP_003409568.1.81091 WP_003409568.1.81119 WP_003409568.1.81125 WP_003409568.1.81136 WP_003409568.1.8114 WP_003409568.1.81189 WP_003409568.1.81192 WP_003409568.1.812 WP_003409568.1.81230 WP_003409568.1.81249 WP_003409568.1.81250 WP_003409568.1.81264 WP_003409568.1.8128 WP_003409568.1.81297 WP_003409568.1.8138 WP_003409568.1.81407 WP_003409568.1.81439 WP_003409568.1.81465 WP_003409568.1.81505 WP_003409568.1.81538 WP_003409568.1.81541 WP_003409568.1.81560 WP_003409568.1.81561 WP_003409568.1.81567 WP_003409568.1.81583 WP_003409568.1.81686 WP_003409568.1.81712 WP_003409568.1.81720 WP_003409568.1.81731 WP_003409568.1.81788 WP_003409568.1.81809 WP_003409568.1.81820 WP_003409568.1.81850 WP_003409568.1.81891 WP_003409568.1.81918 WP_003409568.1.82011 WP_003409568.1.82048 WP_003409568.1.82069 WP_003409568.1.82071 WP_003409568.1.82108 WP_003409568.1.82136 WP_003409568.1.82142 WP_003409568.1.8215 WP_003409568.1.82158 WP_003409568.1.8217 WP_003409568.1.82209 WP_003409568.1.82210 WP_003409568.1.82228 WP_003409568.1.82236 WP_003409568.1.82251 WP_003409568.1.82271 WP_003409568.1.82305 WP_003409568.1.82307 WP_003409568.1.82309 WP_003409568.1.82317 WP_003409568.1.8232 WP_003409568.1.82346 WP_003409568.1.82374 WP_003409568.1.82385 WP_003409568.1.82429 WP_003409568.1.82462 WP_003409568.1.82483 WP_003409568.1.82531 WP_003409568.1.82546 WP_003409568.1.82547 WP_003409568.1.82549 WP_003409568.1.82577 WP_003409568.1.82592 WP_003409568.1.82597 WP_003409568.1.82598 WP_003409568.1.82625 WP_003409568.1.82642 WP_003409568.1.82651 WP_003409568.1.82653 WP_003409568.1.82681 WP_003409568.1.82685 WP_003409568.1.8271 WP_003409568.1.82712 WP_003409568.1.8273 WP_003409568.1.82743 WP_003409568.1.82757 WP_003409568.1.82774 WP_003409568.1.82803 WP_003409568.1.82836 WP_003409568.1.82860 WP_003409568.1.82871 WP_003409568.1.82892 WP_003409568.1.82935 WP_003409568.1.82957 WP_003409568.1.82973 WP_003409568.1.82981 WP_003409568.1.82983 WP_003409568.1.83004 WP_003409568.1.83009 WP_003409568.1.83044 WP_003409568.1.83065 WP_003409568.1.83074 WP_003409568.1.83110 WP_003409568.1.83146 WP_003409568.1.83149 WP_003409568.1.83159 WP_003409568.1.8317 WP_003409568.1.83173 WP_003409568.1.83181 WP_003409568.1.83182 WP_003409568.1.83191 WP_003409568.1.83197 WP_003409568.1.83212 WP_003409568.1.8326 WP_003409568.1.83262 WP_003409568.1.83268 WP_003409568.1.83273 WP_003409568.1.83332 WP_003409568.1.83341 WP_003409568.1.83349 WP_003409568.1.8335 WP_003409568.1.83353 WP_003409568.1.83367 WP_003409568.1.83380 WP_003409568.1.83381 WP_003409568.1.83389 WP_003409568.1.83408 WP_003409568.1.83409 WP_003409568.1.83435 WP_003409568.1.83470 WP_003409568.1.83524 WP_003409568.1.83526 WP_003409568.1.8358 WP_003409568.1.83589 WP_003409568.1.83601 WP_003409568.1.83611 WP_003409568.1.83638 WP_003409568.1.83648 WP_003409568.1.83656 WP_003409568.1.83667 WP_003409568.1.83689 WP_003409568.1.83692 WP_003409568.1.83705 WP_003409568.1.83766 WP_003409568.1.83793 WP_003409568.1.83794 WP_003409568.1.83802 WP_003409568.1.83805 WP_003409568.1.83839 WP_003409568.1.83842 WP_003409568.1.83850 WP_003409568.1.83861 WP_003409568.1.83884 WP_003409568.1.83929 WP_003409568.1.83930 WP_003409568.1.83975 WP_003409568.1.83991 WP_003409568.1.8400 WP_003409568.1.84027 WP_003409568.1.84057 WP_003409568.1.84070 WP_003409568.1.8409 WP_003409568.1.84112 WP_003409568.1.84146 WP_003409568.1.8415 WP_003409568.1.84176 WP_003409568.1.84186 WP_003409568.1.84192 WP_003409568.1.84228 WP_003409568.1.8424 WP_003409568.1.84244 WP_003409568.1.84259 WP_003409568.1.8426 WP_003409568.1.84277 WP_003409568.1.84287 WP_003409568.1.8434 WP_003409568.1.84388 WP_003409568.1.84408 WP_003409568.1.84409 WP_003409568.1.84438 WP_003409568.1.84460 WP_003409568.1.84488 WP_003409568.1.84504 WP_003409568.1.84620 WP_003409568.1.84623 WP_003409568.1.84641 WP_003409568.1.84655 WP_003409568.1.84666 WP_003409568.1.84670 WP_003409568.1.84748 WP_003409568.1.84766 WP_003409568.1.84774 WP_003409568.1.848 WP_003409568.1.84812 WP_003409568.1.84836 WP_003409568.1.84839 WP_003409568.1.84873 WP_003409568.1.84911 WP_003409568.1.84938 WP_003409568.1.84968 WP_003409568.1.84973 WP_003409568.1.84981 WP_003409568.1.84985 WP_003409568.1.8503 WP_003409568.1.85038 WP_003409568.1.85041 WP_003409568.1.85043 WP_003409568.1.8505 WP_003409568.1.85074 WP_003409568.1.8509 WP_003409568.1.8512 WP_003409568.1.85148 WP_003409568.1.8518 WP_003409568.1.8522 WP_003409568.1.85242 WP_003409568.1.85276 WP_003409568.1.85281 WP_003409568.1.85284 WP_003409568.1.85314 WP_003409568.1.85319 WP_003409568.1.85330 WP_003409568.1.85341 WP_003409568.1.85346 WP_003409568.1.8535 WP_003409568.1.85363 WP_003409568.1.85371 WP_003409568.1.85377 WP_003409568.1.85387 WP_003409568.1.85399 WP_003409568.1.85458 WP_003409568.1.8546 WP_003409568.1.85464 WP_003409568.1.85478 WP_003409568.1.85480 WP_003409568.1.85488 WP_003409568.1.85495 WP_003409568.1.85551 WP_003409568.1.85557 WP_003409568.1.85577 WP_003409568.1.85597 WP_003409568.1.85599 WP_003409568.1.85610 WP_003409568.1.8563 WP_003409568.1.85679 WP_003409568.1.85704 WP_003409568.1.85717 WP_003409568.1.85727 WP_003409568.1.85737 WP_003409568.1.85763 WP_003409568.1.85808 WP_003409568.1.85819 WP_003409568.1.85820 WP_003409568.1.85823 WP_003409568.1.85832 WP_003409568.1.8586 WP_003409568.1.85872 WP_003409568.1.85894 WP_003409568.1.85909 WP_003409568.1.85913 WP_003409568.1.85953 WP_003409568.1.86000 WP_003409568.1.86024 WP_003409568.1.86025 WP_003409568.1.86032 WP_003409568.1.86048 WP_003409568.1.86067 WP_003409568.1.86103 WP_003409568.1.86122 WP_003409568.1.86124 WP_003409568.1.86160 WP_003409568.1.86164 WP_003409568.1.86168 WP_003409568.1.86190 WP_003409568.1.86204 WP_003409568.1.86208 WP_003409568.1.86235 WP_003409568.1.86249 WP_003409568.1.86260 WP_003409568.1.86290 WP_003409568.1.863 WP_003409568.1.86327 WP_003409568.1.86337 WP_003409568.1.86377 WP_003409568.1.86425 WP_003409568.1.86459 WP_003409568.1.8649 WP_003409568.1.86499 WP_003409568.1.86520 WP_003409568.1.86561 WP_003409568.1.86568 WP_003409568.1.86575 WP_003409568.1.86584 WP_003409568.1.86605 WP_003409568.1.86626 WP_003409568.1.86648 WP_003409568.1.8666 WP_003409568.1.86684 WP_003409568.1.86696 WP_003409568.1.86705 WP_003409568.1.86718 WP_003409568.1.86725 WP_003409568.1.86757 WP_003409568.1.86766 WP_003409568.1.86814 WP_003409568.1.86820 WP_003409568.1.86825 WP_003409568.1.86834 WP_003409568.1.8685 WP_003409568.1.86851 WP_003409568.1.86855 WP_003409568.1.86867 WP_003409568.1.86877 WP_003409568.1.86883 WP_003409568.1.8689 WP_003409568.1.86892 WP_003409568.1.86933 WP_003409568.1.86941 WP_003409568.1.86950 WP_003409568.1.86962 WP_003409568.1.86979 WP_003409568.1.8700 WP_003409568.1.87001 WP_003409568.1.87002 WP_003409568.1.87031 WP_003409568.1.87116 WP_003409568.1.87117 WP_003409568.1.8714 WP_003409568.1.87162 WP_003409568.1.87178 WP_003409568.1.87191 WP_003409568.1.87201 WP_003409568.1.87209 WP_003409568.1.87240 WP_003409568.1.87266 WP_003409568.1.87273 WP_003409568.1.87275 WP_003409568.1.8733 WP_003409568.1.87345 WP_003409568.1.8737 WP_003409568.1.87401 WP_003409568.1.87404 WP_003409568.1.87406 WP_003409568.1.87409 WP_003409568.1.87444 WP_003409568.1.87446 WP_003409568.1.87459 WP_003409568.1.87472 WP_003409568.1.87489 WP_003409568.1.87494 WP_003409568.1.87496 WP_003409568.1.87582 WP_003409568.1.87588 WP_003409568.1.87617 WP_003409568.1.87619 WP_003409568.1.87620 WP_003409568.1.87634 WP_003409568.1.87643 WP_003409568.1.8765 WP_003409568.1.87650 WP_003409568.1.87654 WP_003409568.1.87658 WP_003409568.1.87665 WP_003409568.1.87677 WP_003409568.1.87692 WP_003409568.1.87732 WP_003409568.1.87784 WP_003409568.1.87796 WP_003409568.1.87809 WP_003409568.1.87817 WP_003409568.1.87827 WP_003409568.1.87831 WP_003409568.1.87835 WP_003409568.1.87837 WP_003409568.1.87866 WP_003409568.1.8789 WP_003409568.1.87911 WP_003409568.1.87924 WP_003409568.1.87951 WP_003409568.1.87955 WP_003409568.1.87956 WP_003409568.1.87991 WP_003409568.1.88 WP_003409568.1.88002 WP_003409568.1.88037 WP_003409568.1.88039 WP_003409568.1.88072 WP_003409568.1.88077 WP_003409568.1.88121 WP_003409568.1.88191 WP_003409568.1.88205 WP_003409568.1.88217 WP_003409568.1.88245 WP_003409568.1.88253 WP_003409568.1.88294 WP_003409568.1.88315 WP_003409568.1.88316 WP_003409568.1.88320 WP_003409568.1.88338 WP_003409568.1.8840 WP_003409568.1.88437 WP_003409568.1.88469 WP_003409568.1.88489 WP_003409568.1.88507 WP_003409568.1.88521 WP_003409568.1.88530 WP_003409568.1.88537 WP_003409568.1.88541 WP_003409568.1.88592 WP_003409568.1.88616 WP_003409568.1.88618 WP_003409568.1.8862 WP_003409568.1.88625 WP_003409568.1.88632 WP_003409568.1.88634 WP_003409568.1.88649 WP_003409568.1.8870 WP_003409568.1.88737 WP_003409568.1.88756 WP_003409568.1.888 WP_003409568.1.88824 WP_003409568.1.88886 WP_003409568.1.88965 WP_003409568.1.88985 WP_003409568.1.8902 WP_003409568.1.89025 WP_003409568.1.89041 WP_003409568.1.89046 WP_003409568.1.89082 WP_003409568.1.89162 WP_003409568.1.89168 WP_003409568.1.8917 WP_003409568.1.89193 WP_003409568.1.89205 WP_003409568.1.89207 WP_003409568.1.89225 WP_003409568.1.8925 WP_003409568.1.89277 WP_003409568.1.89286 WP_003409568.1.89293 WP_003409568.1.89320 WP_003409568.1.8935 WP_003409568.1.89371 WP_003409568.1.89378 WP_003409568.1.89392 WP_003409568.1.89406 WP_003409568.1.8943 WP_003409568.1.89451 WP_003409568.1.89453 WP_003409568.1.89473 WP_003409568.1.89475 WP_003409568.1.89483 WP_003409568.1.895 WP_003409568.1.89513 WP_003409568.1.89517 WP_003409568.1.89522 WP_003409568.1.8954 WP_003409568.1.89543 WP_003409568.1.89567 WP_003409568.1.8957 WP_003409568.1.89572 WP_003409568.1.89589 WP_003409568.1.89607 WP_003409568.1.89613 WP_003409568.1.89625 WP_003409568.1.89648 WP_003409568.1.8967 WP_003409568.1.89670 WP_003409568.1.89676 WP_003409568.1.89729 WP_003409568.1.89739 WP_003409568.1.89762 WP_003409568.1.8977 WP_003409568.1.89802 WP_003409568.1.89808 WP_003409568.1.89829 WP_003409568.1.89831 WP_003409568.1.89844 WP_003409568.1.89849 WP_003409568.1.8989 WP_003409568.1.89901 WP_003409568.1.89903 WP_003409568.1.89909 WP_003409568.1.89922 WP_003409568.1.89926 WP_003409568.1.89963 WP_003409568.1.89971 WP_003409568.1.8998 WP_003409568.1.89987 WP_003409568.1.900 WP_003409568.1.90048 WP_003409568.1.9007 WP_003409568.1.90080 WP_003409568.1.90130 WP_003409568.1.90134 WP_003409568.1.90137 WP_003409568.1.90157 WP_003409568.1.90184 WP_003409568.1.90199 WP_003409568.1.90231 WP_003409568.1.90245 WP_003409568.1.90308 WP_003409568.1.90322 WP_003409568.1.90328 WP_003409568.1.90372 WP_003409568.1.90439 WP_003409568.1.90481 WP_003409568.1.90499 WP_003409568.1.9050 WP_003409568.1.90527 WP_003409568.1.90550 WP_003409568.1.90560 WP_003409568.1.90612 WP_003409568.1.90640 WP_003409568.1.90672 WP_003409568.1.90687 WP_003409568.1.90691 WP_003409568.1.90711 WP_003409568.1.90722 WP_003409568.1.90744 WP_003409568.1.9075 WP_003409568.1.90756 WP_003409568.1.90767 WP_003409568.1.90771 WP_003409568.1.90785 WP_003409568.1.90788 WP_003409568.1.90800 WP_003409568.1.90810 WP_003409568.1.90816 WP_003409568.1.90819 WP_003409568.1.9082 WP_003409568.1.90831 WP_003409568.1.90884 WP_003409568.1.90899 WP_003409568.1.90906 WP_003409568.1.90958 WP_003409568.1.90976 WP_003409568.1.90977 WP_003409568.1.90987 WP_003409568.1.9102 WP_003409568.1.91026 WP_003409568.1.91032 WP_003409568.1.91043 WP_003409568.1.91053 WP_003409568.1.91082 WP_003409568.1.91106 WP_003409568.1.91112 WP_003409568.1.91144 WP_003409568.1.91151 WP_003409568.1.91157 WP_003409568.1.91167 WP_003409568.1.91169 WP_003409568.1.91192 WP_003409568.1.91201 WP_003409568.1.91208 WP_003409568.1.91211 WP_003409568.1.91214 WP_003409568.1.91230 WP_003409568.1.91244 WP_003409568.1.91251 WP_003409568.1.91260 WP_003409568.1.91265 WP_003409568.1.9128 WP_003409568.1.91284 WP_003409568.1.91294 WP_003409568.1.91303 WP_003409568.1.91322 WP_003409568.1.91352 WP_003409568.1.91386 WP_003409568.1.9139 WP_003409568.1.91398 WP_003409568.1.91411 WP_003409568.1.91430 WP_003409568.1.91483 WP_003409568.1.91496 WP_003409568.1.91508 WP_003409568.1.91576 WP_003409568.1.91589 WP_003409568.1.91694 WP_003409568.1.91695 WP_003409568.1.91713 WP_003409568.1.91716 WP_003409568.1.91717 WP_003409568.1.91728 WP_003409568.1.91743 WP_003409568.1.91759 WP_003409568.1.91784 WP_003409568.1.91785 WP_003409568.1.91786 WP_003409568.1.91802 WP_003409568.1.91822 WP_003409568.1.91828 WP_003409568.1.9189 WP_003409568.1.91896 WP_003409568.1.91915 WP_003409568.1.91931 WP_003409568.1.91937 WP_003409568.1.91944 WP_003409568.1.91953 WP_003409568.1.91957 WP_003409568.1.91976 WP_003409568.1.91978 WP_003409568.1.92021 WP_003409568.1.92083 WP_003409568.1.92127 WP_003409568.1.92144 WP_003409568.1.92150 WP_003409568.1.92153 WP_003409568.1.92190 WP_003409568.1.92192 WP_003409568.1.92200 WP_003409568.1.92220 WP_003409568.1.92221 WP_003409568.1.92222 WP_003409568.1.92273 WP_003409568.1.92289 WP_003409568.1.9229 WP_003409568.1.92294 WP_003409568.1.92300 WP_003409568.1.92317 WP_003409568.1.92334 WP_003409568.1.92338 WP_003409568.1.92345 WP_003409568.1.92356 WP_003409568.1.92364 WP_003409568.1.92380 WP_003409568.1.92416 WP_003409568.1.92428 WP_003409568.1.92447 WP_003409568.1.92456 WP_003409568.1.92467 WP_003409568.1.92471 WP_003409568.1.92490 WP_003409568.1.92508 WP_003409568.1.9251 WP_003409568.1.92511 WP_003409568.1.92523 WP_003409568.1.92527 WP_003409568.1.92536 WP_003409568.1.92592 WP_003409568.1.92597 WP_003409568.1.92603 WP_003409568.1.92606 WP_003409568.1.92610 WP_003409568.1.92613 WP_003409568.1.9263 WP_003409568.1.9265 WP_003409568.1.92650 WP_003409568.1.92660 WP_003409568.1.92677 WP_003409568.1.92685 WP_003409568.1.92689 WP_003409568.1.92690 WP_003409568.1.92706 WP_003409568.1.92714 WP_003409568.1.92736 WP_003409568.1.9274 WP_003409568.1.92752 WP_003409568.1.92760 WP_003409568.1.92777 WP_003409568.1.92803 WP_003409568.1.92833 WP_003409568.1.92856 WP_003409568.1.92881 WP_003409568.1.92892 WP_003409568.1.92907 WP_003409568.1.92908 WP_003409568.1.9291 WP_003409568.1.92917 WP_003409568.1.92996 WP_003409568.1.93008 WP_003409568.1.93009 WP_003409568.1.93015 WP_003409568.1.93043 WP_003409568.1.9307 WP_003409568.1.93083 WP_003409568.1.93097 WP_003409568.1.93137 WP_003409568.1.93192 WP_003409568.1.93199 WP_003409568.1.93203 WP_003409568.1.93212 WP_003409568.1.93234 WP_003409568.1.93245 WP_003409568.1.93257 WP_003409568.1.93265 WP_003409568.1.93297 WP_003409568.1.93320 WP_003409568.1.93328 WP_003409568.1.93337 WP_003409568.1.93343 WP_003409568.1.93349 WP_003409568.1.93363 WP_003409568.1.93377 WP_003409568.1.9338 WP_003409568.1.93407 WP_003409568.1.93417 WP_003409568.1.93419 WP_003409568.1.93426 WP_003409568.1.9344 WP_003409568.1.93443 WP_003409568.1.93447 WP_003409568.1.93470 WP_003409568.1.93483 WP_003409568.1.93487 WP_003409568.1.93495 WP_003409568.1.93499 WP_003409568.1.93516 WP_003409568.1.93536 WP_003409568.1.93544 WP_003409568.1.93555 WP_003409568.1.93560 WP_003409568.1.93564 WP_003409568.1.9357 WP_003409568.1.93573 WP_003409568.1.93576 WP_003409568.1.93645 WP_003409568.1.93649 WP_003409568.1.93659 WP_003409568.1.93677 WP_003409568.1.9368 WP_003409568.1.93689 WP_003409568.1.93693 WP_003409568.1.93698 WP_003409568.1.93706 WP_003409568.1.9371 WP_003409568.1.93792 WP_003409568.1.93823 WP_003409568.1.93871 WP_003409568.1.9388 WP_003409568.1.93894 WP_003409568.1.93903 WP_003409568.1.93907 WP_003409568.1.93913 WP_003409568.1.93946 WP_003409568.1.93950 WP_003409568.1.93953 WP_003409568.1.93954 WP_003409568.1.93988 WP_003409568.1.9407 WP_003409568.1.94143 WP_003409568.1.94154 WP_003409568.1.94184 WP_003409568.1.94205 WP_003409568.1.94226 WP_003409568.1.94231 WP_003409568.1.94256 WP_003409568.1.94261 WP_003409568.1.94281 WP_003409568.1.94292 WP_003409568.1.94297 WP_003409568.1.9431 WP_003409568.1.94326 WP_003409568.1.94339 WP_003409568.1.94392 WP_003409568.1.94421 WP_003409568.1.94456 WP_003409568.1.94470 WP_003409568.1.94480 WP_003409568.1.94495 WP_003409568.1.94511 WP_003409568.1.94512 WP_003409568.1.94525 WP_003409568.1.94528 WP_003409568.1.94564 WP_003409568.1.94602 WP_003409568.1.94623 WP_003409568.1.94629 WP_003409568.1.9465 WP_003409568.1.94673 WP_003409568.1.94714 WP_003409568.1.94736 WP_003409568.1.94776 WP_003409568.1.9478 WP_003409568.1.94834 WP_003409568.1.94852 WP_003409568.1.94872 WP_003409568.1.9488 WP_003409568.1.94902 WP_003409568.1.94916 WP_003409568.1.94979 WP_003409568.1.94996 WP_003409568.1.94998 WP_003409568.1.95007 WP_003409568.1.95010 WP_003409568.1.95015 WP_003409568.1.95034 WP_003409568.1.95068 WP_003409568.1.95081 WP_003409568.1.95082 WP_003409568.1.9509 WP_003409568.1.95096 WP_003409568.1.95112 WP_003409568.1.95138 WP_003409568.1.9514 WP_003409568.1.95179 WP_003409568.1.95188 WP_003409568.1.95190 WP_003409568.1.95234 WP_003409568.1.95241 WP_003409568.1.95245 WP_003409568.1.95257 WP_003409568.1.95279 WP_003409568.1.9531 WP_003409568.1.95335 WP_003409568.1.95344 WP_003409568.1.9535 WP_003409568.1.95370 WP_003409568.1.95392 WP_003409568.1.95416 WP_003409568.1.95417 WP_003409568.1.95454 WP_003409568.1.95455 WP_003409568.1.95491 WP_003409568.1.95497 WP_003409568.1.95508 WP_003409568.1.95509 WP_003409568.1.95529 WP_003409568.1.95556 WP_003409568.1.95557 WP_003409568.1.95565 WP_003409568.1.95578 WP_003409568.1.95585 WP_003409568.1.95643 WP_003409568.1.95679 WP_003409568.1.957 WP_003409568.1.95727 WP_003409568.1.95730 WP_003409568.1.95735 WP_003409568.1.95772 WP_003409568.1.95797 WP_003409568.1.95839 WP_003409568.1.9585 WP_003409568.1.9590 WP_003409568.1.95902 WP_003409568.1.95908 WP_003409568.1.95924 WP_003409568.1.95926 WP_003409568.1.95953 WP_003409568.1.95958 WP_003409568.1.95964 WP_003409568.1.95973 WP_003409568.1.96006 WP_003409568.1.9602 WP_003409568.1.96036 WP_003409568.1.96062 WP_003409568.1.96065 WP_003409568.1.96098 WP_003409568.1.96146 WP_003409568.1.96166 WP_003409568.1.96171 WP_003409568.1.96182 WP_003409568.1.96204 WP_003409568.1.96230 WP_003409568.1.96235 WP_003409568.1.96242 WP_003409568.1.96245 WP_003409568.1.96254 WP_003409568.1.96286 WP_003409568.1.96318 WP_003409568.1.96345 WP_003409568.1.96360 WP_003409568.1.96373 WP_003409568.1.96486 WP_003409568.1.96560 WP_003409568.1.96569 WP_003409568.1.96573 WP_003409568.1.96575 WP_003409568.1.96576 WP_003409568.1.96611 WP_003409568.1.96621 WP_003409568.1.9667 WP_003409568.1.96681 WP_003409568.1.96726 WP_003409568.1.96733 WP_003409568.1.96742 WP_003409568.1.9678 WP_003409568.1.96832 WP_003409568.1.9685 WP_003409568.1.97008 WP_003409568.1.97009 WP_003409568.1.97056 WP_003409568.1.97084 WP_003409568.1.97087 WP_003409568.1.97094 WP_003409568.1.97096 WP_003409568.1.97099 WP_003409568.1.97108 WP_003409568.1.97113 WP_003409568.1.97122 WP_003409568.1.97127 WP_003409568.1.97129 WP_003409568.1.97136 WP_003409568.1.9716 WP_003409568.1.97176 WP_003409568.1.97222 WP_003409568.1.97223 WP_003409568.1.97237 WP_003409568.1.97242 WP_003409568.1.97270 WP_003409568.1.97283 WP_003409568.1.97296 WP_003409568.1.97321 WP_003409568.1.97325 WP_003409568.1.97330 WP_003409568.1.97366 WP_003409568.1.97376 WP_003409568.1.97380 WP_003409568.1.9739 WP_003409568.1.97462 WP_003409568.1.97517 WP_003409568.1.97519 WP_003409568.1.97535 WP_003409568.1.97546 WP_003409568.1.97550 WP_003409568.1.97577 WP_003409568.1.97584 WP_003409568.1.9759 WP_003409568.1.97591 WP_003409568.1.97596 WP_003409568.1.97609 WP_003409568.1.97618 WP_003409568.1.9763 WP_003409568.1.97669 WP_003409568.1.97673 WP_003409568.1.97700 WP_003409568.1.97701 WP_003409568.1.9773 WP_003409568.1.97730 WP_003409568.1.97740 WP_003409568.1.97751 WP_003409568.1.97754 WP_003409568.1.97797 WP_003409568.1.9782 WP_003409568.1.9784 WP_003409568.1.97888 WP_003409568.1.9790 WP_003409568.1.9795 WP_003409568.1.97951 WP_003409568.1.97958 WP_003409568.1.97966 WP_003409568.1.97977 WP_003409568.1.97979 WP_003409568.1.97995 WP_003409568.1.98018 WP_003409568.1.98034 WP_003409568.1.98052 WP_003409568.1.98072 WP_003409568.1.98128 WP_003409568.1.98181 WP_003409568.1.98188 WP_003409568.1.98189 WP_003409568.1.98213 WP_003409568.1.98225 WP_003409568.1.98291 WP_003409568.1.98335 WP_003409568.1.98350 WP_003409568.1.98395 WP_003409568.1.98412 WP_003409568.1.98441 WP_003409568.1.98443 WP_003409568.1.9848 WP_003409568.1.98482 WP_003409568.1.98486 WP_003409568.1.98488 WP_003409568.1.98503 WP_003409568.1.98516 WP_003409568.1.98524 WP_003409568.1.98536 WP_003409568.1.98541 WP_003409568.1.98566 WP_003409568.1.98576 WP_003409568.1.98590 WP_003409568.1.98594 WP_003409568.1.98599 WP_003409568.1.98629 WP_003409568.1.98645 WP_003409568.1.98646 WP_003409568.1.98649 WP_003409568.1.98656 WP_003409568.1.9867 WP_003409568.1.98674 WP_003409568.1.98697 WP_003409568.1.98701 WP_003409568.1.98739 WP_003409568.1.98749 WP_003409568.1.98765 WP_003409568.1.98770 WP_003409568.1.98777 WP_003409568.1.98778 WP_003409568.1.98802 WP_003409568.1.98838 WP_003409568.1.98850 WP_003409568.1.98906 WP_003409568.1.98935 WP_003409568.1.98948 WP_003409568.1.98953 WP_003409568.1.98984 WP_003409568.1.99000 WP_003409568.1.99023 WP_003409568.1.99030 WP_003409568.1.99037 WP_003409568.1.99055 WP_003409568.1.99062 WP_003409568.1.99086 WP_003409568.1.99115 WP_003409568.1.99161 WP_003409568.1.99176 WP_003409568.1.99205 WP_003409568.1.99211 WP_003409568.1.99216 WP_003409568.1.99222 WP_003409568.1.99251 WP_003409568.1.99269 WP_003409568.1.99294 WP_003409568.1.99312 WP_003409568.1.99315 WP_003409568.1.99316 WP_003409568.1.99322 WP_003409568.1.99328 WP_003409568.1.99365 WP_003409568.1.99368 WP_003409568.1.99379 WP_003409568.1.99396 WP_003409568.1.99402 WP_003409568.1.99404 WP_003409568.1.99419 WP_003409568.1.99438 WP_003409568.1.99460 WP_003409568.1.99468 WP_003409568.1.99473 WP_003409568.1.99513 WP_003409568.1.99529 WP_003409568.1.99548 WP_003409568.1.99572 WP_003409568.1.99575 WP_003409568.1.99605 WP_003409568.1.99609 WP_003409568.1.99617 WP_003409568.1.99635 WP_003409568.1.99650 WP_003409568.1.99672 WP_003409568.1.99701 WP_003409568.1.99711 WP_003409568.1.99716 WP_003409568.1.99740 WP_003409568.1.99745 WP_003409568.1.9976 WP_003409568.1.99798 WP_003409568.1.99817 WP_003409568.1.99832 WP_003409568.1.99847 WP_003409568.1.99852 WP_003409568.1.99886 WP_003409568.1.99897 WP_003409568.1.99899 WP_003409568.1.99915 WP_003409568.1.9993 WP_003409568.1.99982 WP_003409568.1.99991 gi|479314826|ref|YP_007854878.1| gi|148823123|ref|YP_001287877.1| gi|31793104|ref|NP_855597.1| gi|378771660|ref|YP_005171393.1| gi|339631964|ref|YP_004723606.1| gi|385998687|ref|YP_005916985.1| gi|506926392|ref|YP_008006842.1| gi|224990301|ref|YP_002644988.1| gi|494700327|ref|YP_007965809.1| gi|506926392|ref|YP_008006842.1| gi|433631029|ref|YP_007264657.1| Rv1911c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]