SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121638457|ref|YP_978681.1| from Mycobacterium bovis BCG str. Pasteur 1173P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121638457|ref|YP_978681.1|
Domain Number 1 Region: 117-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.71e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 1.53e-33
Family GAD domain 0.00037
Further Details:      
 
Domain Number 3 Region: 5-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.41e-29
Family Anticodon-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121638457|ref|YP_978681.1|
Sequence length 611
Comment aspartyl-tRNA synthetase [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence
MFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEV
LAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPA
GEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDF
LVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEM
SFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECT
DFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGG
PVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWA
FVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYD
IVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEVEEKFGFLLEAFMFGAPPHGGIAFGW
DRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQRHDQIF
AVTTSHPSVNK
Download sequence
Identical sequences A0A0H3MCX5 A0A1A9E9N7
gi|31793755|ref|NP_856248.1| WP_010950740.1.101146 WP_010950740.1.101996 WP_010950740.1.11587 WP_010950740.1.12187 WP_010950740.1.12710 WP_010950740.1.12801 WP_010950740.1.14658 WP_010950740.1.15345 WP_010950740.1.16973 WP_010950740.1.17039 WP_010950740.1.17314 WP_010950740.1.1768 WP_010950740.1.21742 WP_010950740.1.22680 WP_010950740.1.23140 WP_010950740.1.23497 WP_010950740.1.24062 WP_010950740.1.25965 WP_010950740.1.26265 WP_010950740.1.26412 WP_010950740.1.27254 WP_010950740.1.29559 WP_010950740.1.3043 WP_010950740.1.30669 WP_010950740.1.30732 WP_010950740.1.32822 WP_010950740.1.34111 WP_010950740.1.34358 WP_010950740.1.35173 WP_010950740.1.35680 WP_010950740.1.36246 WP_010950740.1.36657 WP_010950740.1.38135 WP_010950740.1.41583 WP_010950740.1.42201 WP_010950740.1.42417 WP_010950740.1.44016 WP_010950740.1.48109 WP_010950740.1.50860 WP_010950740.1.50868 WP_010950740.1.54502 WP_010950740.1.56729 WP_010950740.1.57616 WP_010950740.1.58000 WP_010950740.1.58101 WP_010950740.1.61256 WP_010950740.1.61778 WP_010950740.1.62360 WP_010950740.1.64966 WP_010950740.1.66013 WP_010950740.1.66460 WP_010950740.1.69181 WP_010950740.1.71621 WP_010950740.1.71820 WP_010950740.1.72218 WP_010950740.1.72219 WP_010950740.1.7266 WP_010950740.1.74477 WP_010950740.1.76976 WP_010950740.1.77093 WP_010950740.1.77166 WP_010950740.1.77879 WP_010950740.1.78429 WP_010950740.1.78544 WP_010950740.1.78848 WP_010950740.1.83268 WP_010950740.1.83704 WP_010950740.1.84911 WP_010950740.1.8943 WP_010950740.1.89802 WP_010950740.1.9128 WP_010950740.1.91411 WP_010950740.1.91508 WP_010950740.1.93008 WP_010950740.1.95908 WP_010950740.1.96204 WP_010950740.1.97330 WP_010950740.1.97568 WP_010950740.1.97596 WP_010950740.1.99037 WP_010950740.1.99269 gi|224990951|ref|YP_002645638.1| gi|449064649|ref|YP_007431732.1| gi|378772312|ref|YP_005172045.1| 233413.Mb2602c 410289.BCG_2595c 561275.JTY_2589 gi|121638457|ref|YP_978681.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]