SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121638845|ref|YP_979069.1| from Mycobacterium bovis BCG str. Pasteur 1173P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121638845|ref|YP_979069.1|
Domain Number 1 Region: 116-310
Classification Level Classification E-value
Superfamily Formyltransferase 8.24e-57
Family Formyltransferase 0.00025
Further Details:      
 
Domain Number 2 Region: 32-107
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000666
Family IlvH-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121638845|ref|YP_979069.1|
Sequence length 310
Comment formyltetrahydrofolate deformylase [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence
MGKGSMTAHATPNEPDYPPPPGGPPPPADIGRLLLRCHDRPGIIAAVSTFLARAGANIIS
LDQHSTAPEGGTFLQRAIFHLPGLTAAVDELQRDFGSTVADKFGIDYRFAEAAKPKRVAI
MASTEDHCLLDLLWRNRRGELEMSVVMVIANHPDLAAHVRPFGVPFIHIPATRDTRTEAE
QRQLQLLSGNVDLVVLARYMQILSPGFLEAIGCPLINIHHSFLPAFTGAAPYQRARERGV
KLIGATAHYVTEVLDEGPIIEQDVVRVDHTHTVDDLVRVGADVERAVLSRAVLWHCQDRV
IVHHNQTIVF
Download sequence
Identical sequences A0A083VX83 A0A0E8L7Y5 A0A0H3LDB6 A0A0H3M8D3 A0A0K2HZY5 A0A109SQZ0 A0A197IU73 A0A1S1BIE9 A5U6X2 G0TG31 P0A5T7 P9WHM2 P9WHM3
gi|197738592|ref|YP_002159907.1| gi|148824153|ref|YP_001288907.1| gi|385999750|ref|YP_005918049.1| gi|15610101|ref|NP_217480.1| gi|121638845|ref|YP_979069.1| gi|340627953|ref|YP_004746405.1| gi|15610101|ref|NP_217480.1| gi|375295215|ref|YP_005099482.1| gi|479056930|ref|YP_007352736.1| gi|386005826|ref|YP_005924105.1| gi|148662811|ref|YP_001284334.1| gi|433628083|ref|YP_007261712.1| gi|471338990|ref|YP_007611703.1| Rv2964 gi|224991337|ref|YP_002646026.1| gi|15842515|ref|NP_337552.1| 233413.Mb2988 336982.TBFG_12978 410289.BCG_2985 419947.MRA_2991 478434.TBMG_01007 561275.JTY_2980 83331.MT3041 83332.Rv2964 gi|392431424|ref|YP_006472468.1| gi|378772701|ref|YP_005172434.1| gi|494701403|ref|YP_007966885.1| gi|525675462|ref|YP_008227054.1| gi|449065047|ref|YP_007432130.1| gi|253797946|ref|YP_003030947.1| NP_217480.1.84033 WP_003899559.1.100000 WP_003899559.1.100021 WP_003899559.1.100087 WP_003899559.1.10015 WP_003899559.1.10022 WP_003899559.1.100260 WP_003899559.1.100270 WP_003899559.1.100279 WP_003899559.1.100286 WP_003899559.1.100309 WP_003899559.1.100318 WP_003899559.1.100337 WP_003899559.1.100338 WP_003899559.1.100395 WP_003899559.1.100396 WP_003899559.1.1004 WP_003899559.1.100401 WP_003899559.1.100459 WP_003899559.1.100552 WP_003899559.1.100581 WP_003899559.1.100600 WP_003899559.1.100625 WP_003899559.1.100666 WP_003899559.1.100671 WP_003899559.1.100677 WP_003899559.1.100682 WP_003899559.1.100757 WP_003899559.1.100772 WP_003899559.1.100812 WP_003899559.1.100845 WP_003899559.1.10088 WP_003899559.1.10090 WP_003899559.1.100910 WP_003899559.1.100918 WP_003899559.1.100935 WP_003899559.1.100992 WP_003899559.1.101 WP_003899559.1.101025 WP_003899559.1.101028 WP_003899559.1.10104 WP_003899559.1.101048 WP_003899559.1.101054 WP_003899559.1.101075 WP_003899559.1.101143 WP_003899559.1.101146 WP_003899559.1.10117 WP_003899559.1.10125 WP_003899559.1.101290 WP_003899559.1.101323 WP_003899559.1.101324 WP_003899559.1.101367 WP_003899559.1.101398 WP_003899559.1.101403 WP_003899559.1.101421 WP_003899559.1.10145 WP_003899559.1.101452 WP_003899559.1.101456 WP_003899559.1.101481 WP_003899559.1.101493 WP_003899559.1.101496 WP_003899559.1.101525 WP_003899559.1.101533 WP_003899559.1.101535 WP_003899559.1.101558 WP_003899559.1.10156 WP_003899559.1.101604 WP_003899559.1.101622 WP_003899559.1.101644 WP_003899559.1.101671 WP_003899559.1.10170 WP_003899559.1.101713 WP_003899559.1.101722 WP_003899559.1.101733 WP_003899559.1.101754 WP_003899559.1.101795 WP_003899559.1.101798 WP_003899559.1.101826 WP_003899559.1.101836 WP_003899559.1.101858 WP_003899559.1.101859 WP_003899559.1.101862 WP_003899559.1.101888 WP_003899559.1.101894 WP_003899559.1.101923 WP_003899559.1.101925 WP_003899559.1.10193 WP_003899559.1.101996 WP_003899559.1.102008 WP_003899559.1.102055 WP_003899559.1.102099 WP_003899559.1.1021 WP_003899559.1.10211 WP_003899559.1.102143 WP_003899559.1.10216 WP_003899559.1.10224 WP_003899559.1.10253 WP_003899559.1.10272 WP_003899559.1.1033 WP_003899559.1.10362 WP_003899559.1.10366 WP_003899559.1.10376 WP_003899559.1.10410 WP_003899559.1.10414 WP_003899559.1.10421 WP_003899559.1.1044 WP_003899559.1.10440 WP_003899559.1.10445 WP_003899559.1.10471 WP_003899559.1.10472 WP_003899559.1.10489 WP_003899559.1.10518 WP_003899559.1.10594 WP_003899559.1.10603 WP_003899559.1.10606 WP_003899559.1.10615 WP_003899559.1.10623 WP_003899559.1.10635 WP_003899559.1.10648 WP_003899559.1.10662 WP_003899559.1.10709 WP_003899559.1.10735 WP_003899559.1.10740 WP_003899559.1.1078 WP_003899559.1.10791 WP_003899559.1.10799 WP_003899559.1.10848 WP_003899559.1.10863 WP_003899559.1.10912 WP_003899559.1.10916 WP_003899559.1.10923 WP_003899559.1.10927 WP_003899559.1.10958 WP_003899559.1.10962 WP_003899559.1.10981 WP_003899559.1.10993 WP_003899559.1.11061 WP_003899559.1.11141 WP_003899559.1.11176 WP_003899559.1.11236 WP_003899559.1.11329 WP_003899559.1.1133 WP_003899559.1.11342 WP_003899559.1.11376 WP_003899559.1.11402 WP_003899559.1.11481 WP_003899559.1.11487 WP_003899559.1.11489 WP_003899559.1.11491 WP_003899559.1.11514 WP_003899559.1.11587 WP_003899559.1.11589 WP_003899559.1.11596 WP_003899559.1.11604 WP_003899559.1.11610 WP_003899559.1.11697 WP_003899559.1.11707 WP_003899559.1.11752 WP_003899559.1.11758 WP_003899559.1.11775 WP_003899559.1.11804 WP_003899559.1.11822 WP_003899559.1.11856 WP_003899559.1.11906 WP_003899559.1.11939 WP_003899559.1.11960 WP_003899559.1.11961 WP_003899559.1.11984 WP_003899559.1.120 WP_003899559.1.12001 WP_003899559.1.12100 WP_003899559.1.12130 WP_003899559.1.12133 WP_003899559.1.12161 WP_003899559.1.12165 WP_003899559.1.12184 WP_003899559.1.12187 WP_003899559.1.12216 WP_003899559.1.12265 WP_003899559.1.12275 WP_003899559.1.12293 WP_003899559.1.123 WP_003899559.1.12314 WP_003899559.1.12327 WP_003899559.1.12338 WP_003899559.1.12371 WP_003899559.1.12372 WP_003899559.1.12389 WP_003899559.1.12406 WP_003899559.1.1241 WP_003899559.1.12421 WP_003899559.1.12424 WP_003899559.1.12446 WP_003899559.1.12464 WP_003899559.1.12479 WP_003899559.1.12519 WP_003899559.1.12523 WP_003899559.1.12526 WP_003899559.1.12551 WP_003899559.1.12611 WP_003899559.1.12669 WP_003899559.1.1267 WP_003899559.1.12672 WP_003899559.1.12710 WP_003899559.1.12768 WP_003899559.1.12794 WP_003899559.1.12801 WP_003899559.1.12821 WP_003899559.1.12841 WP_003899559.1.12854 WP_003899559.1.12871 WP_003899559.1.12901 WP_003899559.1.12941 WP_003899559.1.12972 WP_003899559.1.13028 WP_003899559.1.13086 WP_003899559.1.13087 WP_003899559.1.13163 WP_003899559.1.13249 WP_003899559.1.13282 WP_003899559.1.13296 WP_003899559.1.13298 WP_003899559.1.13302 WP_003899559.1.13312 WP_003899559.1.13313 WP_003899559.1.13321 WP_003899559.1.13345 WP_003899559.1.13370 WP_003899559.1.1338 WP_003899559.1.13420 WP_003899559.1.13433 WP_003899559.1.13435 WP_003899559.1.13438 WP_003899559.1.13489 WP_003899559.1.13526 WP_003899559.1.13551 WP_003899559.1.13579 WP_003899559.1.13667 WP_003899559.1.13687 WP_003899559.1.13719 WP_003899559.1.13763 WP_003899559.1.1377 WP_003899559.1.13774 WP_003899559.1.13786 WP_003899559.1.13793 WP_003899559.1.13817 WP_003899559.1.13880 WP_003899559.1.13899 WP_003899559.1.13909 WP_003899559.1.13952 WP_003899559.1.13953 WP_003899559.1.13962 WP_003899559.1.1398 WP_003899559.1.14027 WP_003899559.1.14115 WP_003899559.1.1415 WP_003899559.1.14152 WP_003899559.1.14162 WP_003899559.1.14175 WP_003899559.1.14194 WP_003899559.1.14195 WP_003899559.1.14238 WP_003899559.1.14273 WP_003899559.1.14306 WP_003899559.1.14310 WP_003899559.1.14341 WP_003899559.1.14382 WP_003899559.1.14428 WP_003899559.1.14441 WP_003899559.1.14469 WP_003899559.1.1452 WP_003899559.1.14527 WP_003899559.1.14544 WP_003899559.1.14551 WP_003899559.1.14561 WP_003899559.1.14573 WP_003899559.1.14658 WP_003899559.1.14668 WP_003899559.1.14675 WP_003899559.1.14694 WP_003899559.1.14695 WP_003899559.1.14709 WP_003899559.1.14766 WP_003899559.1.14783 WP_003899559.1.14865 WP_003899559.1.14872 WP_003899559.1.14905 WP_003899559.1.14955 WP_003899559.1.15003 WP_003899559.1.15009 WP_003899559.1.15040 WP_003899559.1.15065 WP_003899559.1.15089 WP_003899559.1.1509 WP_003899559.1.15126 WP_003899559.1.15172 WP_003899559.1.15174 WP_003899559.1.15187 WP_003899559.1.15196 WP_003899559.1.15217 WP_003899559.1.1523 WP_003899559.1.15240 WP_003899559.1.15253 WP_003899559.1.15267 WP_003899559.1.1527 WP_003899559.1.15292 WP_003899559.1.15302 WP_003899559.1.15322 WP_003899559.1.15345 WP_003899559.1.15372 WP_003899559.1.15386 WP_003899559.1.15442 WP_003899559.1.15447 WP_003899559.1.15477 WP_003899559.1.15511 WP_003899559.1.15558 WP_003899559.1.15559 WP_003899559.1.15566 WP_003899559.1.15599 WP_003899559.1.1560 WP_003899559.1.1563 WP_003899559.1.15633 WP_003899559.1.15643 WP_003899559.1.15755 WP_003899559.1.15763 WP_003899559.1.15774 WP_003899559.1.1578 WP_003899559.1.15780 WP_003899559.1.15827 WP_003899559.1.15870 WP_003899559.1.15877 WP_003899559.1.15896 WP_003899559.1.15926 WP_003899559.1.15933 WP_003899559.1.15958 WP_003899559.1.15973 WP_003899559.1.16009 WP_003899559.1.16055 WP_003899559.1.16066 WP_003899559.1.16077 WP_003899559.1.16108 WP_003899559.1.16130 WP_003899559.1.16136 WP_003899559.1.16139 WP_003899559.1.16141 WP_003899559.1.1630 WP_003899559.1.1632 WP_003899559.1.16327 WP_003899559.1.16334 WP_003899559.1.16374 WP_003899559.1.16384 WP_003899559.1.16386 WP_003899559.1.1642 WP_003899559.1.16421 WP_003899559.1.16424 WP_003899559.1.16426 WP_003899559.1.16431 WP_003899559.1.1644 WP_003899559.1.16442 WP_003899559.1.16448 WP_003899559.1.16451 WP_003899559.1.16476 WP_003899559.1.16494 WP_003899559.1.1652 WP_003899559.1.16609 WP_003899559.1.16620 WP_003899559.1.16622 WP_003899559.1.16724 WP_003899559.1.16731 WP_003899559.1.1683 WP_003899559.1.16937 WP_003899559.1.16940 WP_003899559.1.16959 WP_003899559.1.16968 WP_003899559.1.1697 WP_003899559.1.16973 WP_003899559.1.17006 WP_003899559.1.17039 WP_003899559.1.17041 WP_003899559.1.17057 WP_003899559.1.17062 WP_003899559.1.1707 WP_003899559.1.17130 WP_003899559.1.17138 WP_003899559.1.17167 WP_003899559.1.17224 WP_003899559.1.17251 WP_003899559.1.17314 WP_003899559.1.17345 WP_003899559.1.17381 WP_003899559.1.17391 WP_003899559.1.1743 WP_003899559.1.17440 WP_003899559.1.17466 WP_003899559.1.17477 WP_003899559.1.17483 WP_003899559.1.17553 WP_003899559.1.17635 WP_003899559.1.17679 WP_003899559.1.1768 WP_003899559.1.17713 WP_003899559.1.17722 WP_003899559.1.17746 WP_003899559.1.17788 WP_003899559.1.17803 WP_003899559.1.17816 WP_003899559.1.17923 WP_003899559.1.1795 WP_003899559.1.17955 WP_003899559.1.17973 WP_003899559.1.18013 WP_003899559.1.18033 WP_003899559.1.18057 WP_003899559.1.18065 WP_003899559.1.18070 WP_003899559.1.18120 WP_003899559.1.18126 WP_003899559.1.1817 WP_003899559.1.18240 WP_003899559.1.18257 WP_003899559.1.18297 WP_003899559.1.18306 WP_003899559.1.18364 WP_003899559.1.18399 WP_003899559.1.18444 WP_003899559.1.18448 WP_003899559.1.18467 WP_003899559.1.18582 WP_003899559.1.18587 WP_003899559.1.18639 WP_003899559.1.1868 WP_003899559.1.18694 WP_003899559.1.18710 WP_003899559.1.18751 WP_003899559.1.18793 WP_003899559.1.18827 WP_003899559.1.18838 WP_003899559.1.18945 WP_003899559.1.19005 WP_003899559.1.19063 WP_003899559.1.19066 WP_003899559.1.19085 WP_003899559.1.19094 WP_003899559.1.19144 WP_003899559.1.19159 WP_003899559.1.19193 WP_003899559.1.19231 WP_003899559.1.19264 WP_003899559.1.19295 WP_003899559.1.19307 WP_003899559.1.19326 WP_003899559.1.1933 WP_003899559.1.19364 WP_003899559.1.19426 WP_003899559.1.19429 WP_003899559.1.19464 WP_003899559.1.19512 WP_003899559.1.19562 WP_003899559.1.19564 WP_003899559.1.19568 WP_003899559.1.19572 WP_003899559.1.19595 WP_003899559.1.19600 WP_003899559.1.19630 WP_003899559.1.19694 WP_003899559.1.19742 WP_003899559.1.19820 WP_003899559.1.19868 WP_003899559.1.19874 WP_003899559.1.19890 WP_003899559.1.19900 WP_003899559.1.19946 WP_003899559.1.19949 WP_003899559.1.19960 WP_003899559.1.20007 WP_003899559.1.20016 WP_003899559.1.20028 WP_003899559.1.2003 WP_003899559.1.20037 WP_003899559.1.20039 WP_003899559.1.20082 WP_003899559.1.20116 WP_003899559.1.20140 WP_003899559.1.20141 WP_003899559.1.20158 WP_003899559.1.20239 WP_003899559.1.20259 WP_003899559.1.20262 WP_003899559.1.20268 WP_003899559.1.20272 WP_003899559.1.20273 WP_003899559.1.20280 WP_003899559.1.20294 WP_003899559.1.20300 WP_003899559.1.20322 WP_003899559.1.2037 WP_003899559.1.20372 WP_003899559.1.20381 WP_003899559.1.204 WP_003899559.1.20427 WP_003899559.1.20432 WP_003899559.1.20457 WP_003899559.1.20460 WP_003899559.1.20608 WP_003899559.1.20624 WP_003899559.1.20628 WP_003899559.1.2066 WP_003899559.1.20722 WP_003899559.1.2086 WP_003899559.1.20868 WP_003899559.1.20897 WP_003899559.1.20898 WP_003899559.1.2090 WP_003899559.1.20911 WP_003899559.1.20921 WP_003899559.1.20926 WP_003899559.1.20927 WP_003899559.1.20970 WP_003899559.1.2104 WP_003899559.1.21135 WP_003899559.1.21173 WP_003899559.1.21187 WP_003899559.1.2120 WP_003899559.1.2123 WP_003899559.1.21292 WP_003899559.1.21307 WP_003899559.1.21311 WP_003899559.1.21321 WP_003899559.1.2137 WP_003899559.1.21392 WP_003899559.1.21397 WP_003899559.1.21415 WP_003899559.1.21418 WP_003899559.1.21430 WP_003899559.1.21434 WP_003899559.1.21444 WP_003899559.1.21509 WP_003899559.1.21560 WP_003899559.1.21591 WP_003899559.1.21594 WP_003899559.1.21615 WP_003899559.1.21655 WP_003899559.1.21658 WP_003899559.1.2168 WP_003899559.1.2174 WP_003899559.1.21741 WP_003899559.1.21742 WP_003899559.1.21786 WP_003899559.1.21795 WP_003899559.1.218 WP_003899559.1.21829 WP_003899559.1.21840 WP_003899559.1.21843 WP_003899559.1.21872 WP_003899559.1.2188 WP_003899559.1.21882 WP_003899559.1.21906 WP_003899559.1.21912 WP_003899559.1.21941 WP_003899559.1.21960 WP_003899559.1.21971 WP_003899559.1.22025 WP_003899559.1.22036 WP_003899559.1.22092 WP_003899559.1.22127 WP_003899559.1.22140 WP_003899559.1.22305 WP_003899559.1.22348 WP_003899559.1.22356 WP_003899559.1.2238 WP_003899559.1.22437 WP_003899559.1.22445 WP_003899559.1.22490 WP_003899559.1.22511 WP_003899559.1.22524 WP_003899559.1.2253 WP_003899559.1.22585 WP_003899559.1.22589 WP_003899559.1.22606 WP_003899559.1.22608 WP_003899559.1.22618 WP_003899559.1.2262 WP_003899559.1.22629 WP_003899559.1.22647 WP_003899559.1.22664 WP_003899559.1.22674 WP_003899559.1.22680 WP_003899559.1.22725 WP_003899559.1.22728 WP_003899559.1.22733 WP_003899559.1.22737 WP_003899559.1.2275 WP_003899559.1.22797 WP_003899559.1.22829 WP_003899559.1.22844 WP_003899559.1.22963 WP_003899559.1.22997 WP_003899559.1.22999 WP_003899559.1.23015 WP_003899559.1.231 WP_003899559.1.23101 WP_003899559.1.23140 WP_003899559.1.23153 WP_003899559.1.23171 WP_003899559.1.23199 WP_003899559.1.2320 WP_003899559.1.23216 WP_003899559.1.23233 WP_003899559.1.23261 WP_003899559.1.23272 WP_003899559.1.23289 WP_003899559.1.2329 WP_003899559.1.23308 WP_003899559.1.23316 WP_003899559.1.23321 WP_003899559.1.2339 WP_003899559.1.23406 WP_003899559.1.23438 WP_003899559.1.23445 WP_003899559.1.23447 WP_003899559.1.23452 WP_003899559.1.23461 WP_003899559.1.23497 WP_003899559.1.23506 WP_003899559.1.23530 WP_003899559.1.23546 WP_003899559.1.23573 WP_003899559.1.23628 WP_003899559.1.23683 WP_003899559.1.23692 WP_003899559.1.23699 WP_003899559.1.23832 WP_003899559.1.2384 WP_003899559.1.23863 WP_003899559.1.23894 WP_003899559.1.23993 WP_003899559.1.24007 WP_003899559.1.24008 WP_003899559.1.24046 WP_003899559.1.24057 WP_003899559.1.24062 WP_003899559.1.24113 WP_003899559.1.24119 WP_003899559.1.24128 WP_003899559.1.24140 WP_003899559.1.24202 WP_003899559.1.24244 WP_003899559.1.24284 WP_003899559.1.24396 WP_003899559.1.24414 WP_003899559.1.24423 WP_003899559.1.2443 WP_003899559.1.24446 WP_003899559.1.24507 WP_003899559.1.24509 WP_003899559.1.24553 WP_003899559.1.24599 WP_003899559.1.24629 WP_003899559.1.24638 WP_003899559.1.2466 WP_003899559.1.24767 WP_003899559.1.24824 WP_003899559.1.24831 WP_003899559.1.24840 WP_003899559.1.24848 WP_003899559.1.24857 WP_003899559.1.2487 WP_003899559.1.24893 WP_003899559.1.24907 WP_003899559.1.24958 WP_003899559.1.24985 WP_003899559.1.2499 WP_003899559.1.2507 WP_003899559.1.25103 WP_003899559.1.25129 WP_003899559.1.25171 WP_003899559.1.25247 WP_003899559.1.25252 WP_003899559.1.25278 WP_003899559.1.25283 WP_003899559.1.25313 WP_003899559.1.25338 WP_003899559.1.25342 WP_003899559.1.25343 WP_003899559.1.25406 WP_003899559.1.25435 WP_003899559.1.25437 WP_003899559.1.25445 WP_003899559.1.25473 WP_003899559.1.25504 WP_003899559.1.25513 WP_003899559.1.25542 WP_003899559.1.25579 WP_003899559.1.25594 WP_003899559.1.25606 WP_003899559.1.25645 WP_003899559.1.25674 WP_003899559.1.25699 WP_003899559.1.25736 WP_003899559.1.25756 WP_003899559.1.25759 WP_003899559.1.25813 WP_003899559.1.25853 WP_003899559.1.25854 WP_003899559.1.25874 WP_003899559.1.25885 WP_003899559.1.25892 WP_003899559.1.25906 WP_003899559.1.25914 WP_003899559.1.25916 WP_003899559.1.25965 WP_003899559.1.25972 WP_003899559.1.26017 WP_003899559.1.26032 WP_003899559.1.26072 WP_003899559.1.26089 WP_003899559.1.26098 WP_003899559.1.26126 WP_003899559.1.26168 WP_003899559.1.26182 WP_003899559.1.26190 WP_003899559.1.2620 WP_003899559.1.26234 WP_003899559.1.26243 WP_003899559.1.26265 WP_003899559.1.26267 WP_003899559.1.26310 WP_003899559.1.26349 WP_003899559.1.26366 WP_003899559.1.26374 WP_003899559.1.26407 WP_003899559.1.26412 WP_003899559.1.26454 WP_003899559.1.26464 WP_003899559.1.2653 WP_003899559.1.26603 WP_003899559.1.26629 WP_003899559.1.26651 WP_003899559.1.26707 WP_003899559.1.26719 WP_003899559.1.26738 WP_003899559.1.26745 WP_003899559.1.26756 WP_003899559.1.2676 WP_003899559.1.26780 WP_003899559.1.26854 WP_003899559.1.26868 WP_003899559.1.26876 WP_003899559.1.26888 WP_003899559.1.26959 WP_003899559.1.26969 WP_003899559.1.26984 WP_003899559.1.27004 WP_003899559.1.27017 WP_003899559.1.27045 WP_003899559.1.27075 WP_003899559.1.27128 WP_003899559.1.27130 WP_003899559.1.27139 WP_003899559.1.27152 WP_003899559.1.27162 WP_003899559.1.27164 WP_003899559.1.27193 WP_003899559.1.27235 WP_003899559.1.27254 WP_003899559.1.27352 WP_003899559.1.27369 WP_003899559.1.27391 WP_003899559.1.27398 WP_003899559.1.27402 WP_003899559.1.27410 WP_003899559.1.27411 WP_003899559.1.27449 WP_003899559.1.27463 WP_003899559.1.2749 WP_003899559.1.27492 WP_003899559.1.27528 WP_003899559.1.27541 WP_003899559.1.27582 WP_003899559.1.27596 WP_003899559.1.27607 WP_003899559.1.27724 WP_003899559.1.27730 WP_003899559.1.27736 WP_003899559.1.27743 WP_003899559.1.27771 WP_003899559.1.27779 WP_003899559.1.27803 WP_003899559.1.27819 WP_003899559.1.27835 WP_003899559.1.27915 WP_003899559.1.27935 WP_003899559.1.27962 WP_003899559.1.28053 WP_003899559.1.28106 WP_003899559.1.28142 WP_003899559.1.2816 WP_003899559.1.28192 WP_003899559.1.28202 WP_003899559.1.28241 WP_003899559.1.28242 WP_003899559.1.28251 WP_003899559.1.28255 WP_003899559.1.28269 WP_003899559.1.28276 WP_003899559.1.28293 WP_003899559.1.28331 WP_003899559.1.28391 WP_003899559.1.28448 WP_003899559.1.28471 WP_003899559.1.28610 WP_003899559.1.28634 WP_003899559.1.28642 WP_003899559.1.28671 WP_003899559.1.28682 WP_003899559.1.28703 WP_003899559.1.28739 WP_003899559.1.28758 WP_003899559.1.28781 WP_003899559.1.28850 WP_003899559.1.28914 WP_003899559.1.28935 WP_003899559.1.28939 WP_003899559.1.28952 WP_003899559.1.28975 WP_003899559.1.28993 WP_003899559.1.2901 WP_003899559.1.29028 WP_003899559.1.29078 WP_003899559.1.29102 WP_003899559.1.29217 WP_003899559.1.29223 WP_003899559.1.29234 WP_003899559.1.29264 WP_003899559.1.29275 WP_003899559.1.29339 WP_003899559.1.29348 WP_003899559.1.29367 WP_003899559.1.29399 WP_003899559.1.29426 WP_003899559.1.29449 WP_003899559.1.29450 WP_003899559.1.29452 WP_003899559.1.2949 WP_003899559.1.29510 WP_003899559.1.29515 WP_003899559.1.2953 WP_003899559.1.29559 WP_003899559.1.2959 WP_003899559.1.29592 WP_003899559.1.29599 WP_003899559.1.29611 WP_003899559.1.29632 WP_003899559.1.29649 WP_003899559.1.2965 WP_003899559.1.29659 WP_003899559.1.2969 WP_003899559.1.29698 WP_003899559.1.29718 WP_003899559.1.29742 WP_003899559.1.29745 WP_003899559.1.29769 WP_003899559.1.29825 WP_003899559.1.29847 WP_003899559.1.29883 WP_003899559.1.299 WP_003899559.1.29960 WP_003899559.1.30014 WP_003899559.1.3004 WP_003899559.1.30040 WP_003899559.1.30074 WP_003899559.1.30097 WP_003899559.1.30101 WP_003899559.1.30106 WP_003899559.1.30114 WP_003899559.1.30126 WP_003899559.1.30131 WP_003899559.1.30138 WP_003899559.1.30139 WP_003899559.1.30145 WP_003899559.1.30211 WP_003899559.1.30224 WP_003899559.1.3027 WP_003899559.1.30279 WP_003899559.1.30282 WP_003899559.1.30283 WP_003899559.1.30288 WP_003899559.1.30291 WP_003899559.1.30363 WP_003899559.1.30374 WP_003899559.1.30404 WP_003899559.1.3043 WP_003899559.1.30433 WP_003899559.1.30462 WP_003899559.1.30464 WP_003899559.1.30468 WP_003899559.1.30500 WP_003899559.1.30574 WP_003899559.1.30628 WP_003899559.1.30641 WP_003899559.1.30661 WP_003899559.1.30669 WP_003899559.1.30683 WP_003899559.1.30699 WP_003899559.1.30730 WP_003899559.1.30732 WP_003899559.1.30736 WP_003899559.1.30745 WP_003899559.1.30760 WP_003899559.1.30791 WP_003899559.1.308 WP_003899559.1.30824 WP_003899559.1.30877 WP_003899559.1.30888 WP_003899559.1.30901 WP_003899559.1.30912 WP_003899559.1.30913 WP_003899559.1.30914 WP_003899559.1.30919 WP_003899559.1.3100 WP_003899559.1.3101 WP_003899559.1.31034 WP_003899559.1.31047 WP_003899559.1.31070 WP_003899559.1.31102 WP_003899559.1.31184 WP_003899559.1.31226 WP_003899559.1.31233 WP_003899559.1.31270 WP_003899559.1.31287 WP_003899559.1.31304 WP_003899559.1.31346 WP_003899559.1.31348 WP_003899559.1.31354 WP_003899559.1.31428 WP_003899559.1.31458 WP_003899559.1.31498 WP_003899559.1.31507 WP_003899559.1.31569 WP_003899559.1.316 WP_003899559.1.31629 WP_003899559.1.31744 WP_003899559.1.31776 WP_003899559.1.31783 WP_003899559.1.318 WP_003899559.1.31840 WP_003899559.1.31880 WP_003899559.1.31911 WP_003899559.1.31955 WP_003899559.1.31991 WP_003899559.1.32004 WP_003899559.1.32039 WP_003899559.1.3204 WP_003899559.1.32045 WP_003899559.1.32071 WP_003899559.1.32132 WP_003899559.1.32157 WP_003899559.1.32164 WP_003899559.1.32179 WP_003899559.1.32317 WP_003899559.1.32383 WP_003899559.1.32403 WP_003899559.1.32416 WP_003899559.1.32461 WP_003899559.1.32482 WP_003899559.1.32503 WP_003899559.1.32562 WP_003899559.1.32647 WP_003899559.1.32653 WP_003899559.1.32654 WP_003899559.1.32695 WP_003899559.1.32706 WP_003899559.1.32716 WP_003899559.1.32752 WP_003899559.1.32780 WP_003899559.1.32781 WP_003899559.1.32793 WP_003899559.1.32799 WP_003899559.1.32822 WP_003899559.1.32833 WP_003899559.1.32862 WP_003899559.1.32880 WP_003899559.1.32909 WP_003899559.1.33007 WP_003899559.1.3302 WP_003899559.1.33028 WP_003899559.1.33035 WP_003899559.1.33044 WP_003899559.1.33054 WP_003899559.1.33141 WP_003899559.1.33148 WP_003899559.1.33155 WP_003899559.1.33168 WP_003899559.1.33215 WP_003899559.1.33278 WP_003899559.1.33288 WP_003899559.1.33305 WP_003899559.1.3331 WP_003899559.1.3333 WP_003899559.1.33393 WP_003899559.1.33403 WP_003899559.1.33452 WP_003899559.1.33467 WP_003899559.1.3349 WP_003899559.1.33519 WP_003899559.1.33542 WP_003899559.1.33601 WP_003899559.1.33633 WP_003899559.1.33646 WP_003899559.1.33673 WP_003899559.1.33705 WP_003899559.1.33762 WP_003899559.1.33783 WP_003899559.1.3383 WP_003899559.1.33832 WP_003899559.1.33839 WP_003899559.1.33848 WP_003899559.1.3387 WP_003899559.1.33886 WP_003899559.1.33906 WP_003899559.1.33912 WP_003899559.1.33954 WP_003899559.1.3399 WP_003899559.1.34042 WP_003899559.1.3405 WP_003899559.1.34055 WP_003899559.1.34056 WP_003899559.1.34065 WP_003899559.1.34090 WP_003899559.1.34109 WP_003899559.1.34111 WP_003899559.1.34131 WP_003899559.1.34152 WP_003899559.1.34153 WP_003899559.1.34181 WP_003899559.1.34197 WP_003899559.1.34198 WP_003899559.1.34215 WP_003899559.1.34219 WP_003899559.1.34255 WP_003899559.1.34260 WP_003899559.1.34275 WP_003899559.1.343 WP_003899559.1.34358 WP_003899559.1.344 WP_003899559.1.3443 WP_003899559.1.34435 WP_003899559.1.34505 WP_003899559.1.34516 WP_003899559.1.34529 WP_003899559.1.34551 WP_003899559.1.34563 WP_003899559.1.34576 WP_003899559.1.34588 WP_003899559.1.34599 WP_003899559.1.34639 WP_003899559.1.34673 WP_003899559.1.34755 WP_003899559.1.34783 WP_003899559.1.34908 WP_003899559.1.3492 WP_003899559.1.34933 WP_003899559.1.34946 WP_003899559.1.34954 WP_003899559.1.34963 WP_003899559.1.34968 WP_003899559.1.35023 WP_003899559.1.35069 WP_003899559.1.35072 WP_003899559.1.35078 WP_003899559.1.35100 WP_003899559.1.35146 WP_003899559.1.35156 WP_003899559.1.35160 WP_003899559.1.35162 WP_003899559.1.35173 WP_003899559.1.3520 WP_003899559.1.35213 WP_003899559.1.35246 WP_003899559.1.35278 WP_003899559.1.35301 WP_003899559.1.35311 WP_003899559.1.35312 WP_003899559.1.35319 WP_003899559.1.35347 WP_003899559.1.35363 WP_003899559.1.35385 WP_003899559.1.35396 WP_003899559.1.35439 WP_003899559.1.35484 WP_003899559.1.35492 WP_003899559.1.3553 WP_003899559.1.35555 WP_003899559.1.35561 WP_003899559.1.35602 WP_003899559.1.35610 WP_003899559.1.35680 WP_003899559.1.35689 WP_003899559.1.35767 WP_003899559.1.35770 WP_003899559.1.35780 WP_003899559.1.35805 WP_003899559.1.35811 WP_003899559.1.35821 WP_003899559.1.3584 WP_003899559.1.35864 WP_003899559.1.35874 WP_003899559.1.35876 WP_003899559.1.35897 WP_003899559.1.35923 WP_003899559.1.3593 WP_003899559.1.36005 WP_003899559.1.36023 WP_003899559.1.36053 WP_003899559.1.36089 WP_003899559.1.36116 WP_003899559.1.36145 WP_003899559.1.36156 WP_003899559.1.36228 WP_003899559.1.36246 WP_003899559.1.36252 WP_003899559.1.36260 WP_003899559.1.36270 WP_003899559.1.36271 WP_003899559.1.36303 WP_003899559.1.36309 WP_003899559.1.36315 WP_003899559.1.36321 WP_003899559.1.3634 WP_003899559.1.36357 WP_003899559.1.3636 WP_003899559.1.36436 WP_003899559.1.36465 WP_003899559.1.36469 WP_003899559.1.36473 WP_003899559.1.36485 WP_003899559.1.36508 WP_003899559.1.36561 WP_003899559.1.36573 WP_003899559.1.36585 WP_003899559.1.36597 WP_003899559.1.36614 WP_003899559.1.36657 WP_003899559.1.36674 WP_003899559.1.36720 WP_003899559.1.36727 WP_003899559.1.36785 WP_003899559.1.36810 WP_003899559.1.36844 WP_003899559.1.36851 WP_003899559.1.36862 WP_003899559.1.36921 WP_003899559.1.36935 WP_003899559.1.36941 WP_003899559.1.3695 WP_003899559.1.36951 WP_003899559.1.37004 WP_003899559.1.37012 WP_003899559.1.37071 WP_003899559.1.37088 WP_003899559.1.37131 WP_003899559.1.37157 WP_003899559.1.37188 WP_003899559.1.37213 WP_003899559.1.3724 WP_003899559.1.37277 WP_003899559.1.37305 WP_003899559.1.37330 WP_003899559.1.37440 WP_003899559.1.37468 WP_003899559.1.37601 WP_003899559.1.37612 WP_003899559.1.37632 WP_003899559.1.37643 WP_003899559.1.37655 WP_003899559.1.37674 WP_003899559.1.37700 WP_003899559.1.37701 WP_003899559.1.37709 WP_003899559.1.37711 WP_003899559.1.37765 WP_003899559.1.37772 WP_003899559.1.37804 WP_003899559.1.37859 WP_003899559.1.37877 WP_003899559.1.37912 WP_003899559.1.37913 WP_003899559.1.37943 WP_003899559.1.37950 WP_003899559.1.37983 WP_003899559.1.38002 WP_003899559.1.3802 WP_003899559.1.38039 WP_003899559.1.38040 WP_003899559.1.38067 WP_003899559.1.38135 WP_003899559.1.38138 WP_003899559.1.38144 WP_003899559.1.38159 WP_003899559.1.38210 WP_003899559.1.38240 WP_003899559.1.38299 WP_003899559.1.38347 WP_003899559.1.38354 WP_003899559.1.38380 WP_003899559.1.38384 WP_003899559.1.38389 WP_003899559.1.38402 WP_003899559.1.38418 WP_003899559.1.38477 WP_003899559.1.38483 WP_003899559.1.3849 WP_003899559.1.38535 WP_003899559.1.38539 WP_003899559.1.38601 WP_003899559.1.38611 WP_003899559.1.38638 WP_003899559.1.38639 WP_003899559.1.38646 WP_003899559.1.38648 WP_003899559.1.38654 WP_003899559.1.38659 WP_003899559.1.38666 WP_003899559.1.38671 WP_003899559.1.38677 WP_003899559.1.38750 WP_003899559.1.38812 WP_003899559.1.38844 WP_003899559.1.38863 WP_003899559.1.38865 WP_003899559.1.38873 WP_003899559.1.38894 WP_003899559.1.38909 WP_003899559.1.38939 WP_003899559.1.38975 WP_003899559.1.39025 WP_003899559.1.39070 WP_003899559.1.39072 WP_003899559.1.39095 WP_003899559.1.39106 WP_003899559.1.39165 WP_003899559.1.39176 WP_003899559.1.39201 WP_003899559.1.39207 WP_003899559.1.39211 WP_003899559.1.39239 WP_003899559.1.39252 WP_003899559.1.39288 WP_003899559.1.39359 WP_003899559.1.39400 WP_003899559.1.39447 WP_003899559.1.3945 WP_003899559.1.39450 WP_003899559.1.39455 WP_003899559.1.3949 WP_003899559.1.39560 WP_003899559.1.39592 WP_003899559.1.39593 WP_003899559.1.396 WP_003899559.1.3960 WP_003899559.1.39657 WP_003899559.1.39661 WP_003899559.1.39674 WP_003899559.1.39678 WP_003899559.1.3968 WP_003899559.1.39694 WP_003899559.1.3971 WP_003899559.1.39718 WP_003899559.1.39739 WP_003899559.1.39748 WP_003899559.1.39751 WP_003899559.1.39801 WP_003899559.1.39877 WP_003899559.1.39925 WP_003899559.1.3996 WP_003899559.1.39980 WP_003899559.1.40000 WP_003899559.1.40028 WP_003899559.1.40029 WP_003899559.1.4003 WP_003899559.1.40094 WP_003899559.1.40096 WP_003899559.1.40156 WP_003899559.1.40174 WP_003899559.1.40276 WP_003899559.1.40353 WP_003899559.1.40372 WP_003899559.1.40440 WP_003899559.1.40446 WP_003899559.1.40451 WP_003899559.1.40543 WP_003899559.1.40641 WP_003899559.1.40651 WP_003899559.1.40653 WP_003899559.1.4067 WP_003899559.1.40705 WP_003899559.1.40731 WP_003899559.1.40735 WP_003899559.1.40795 WP_003899559.1.40799 WP_003899559.1.40852 WP_003899559.1.40881 WP_003899559.1.40922 WP_003899559.1.40948 WP_003899559.1.4095 WP_003899559.1.40956 WP_003899559.1.40957 WP_003899559.1.40964 WP_003899559.1.4097 WP_003899559.1.410 WP_003899559.1.41000 WP_003899559.1.41055 WP_003899559.1.41123 WP_003899559.1.41177 WP_003899559.1.41219 WP_003899559.1.4127 WP_003899559.1.41296 WP_003899559.1.41355 WP_003899559.1.41376 WP_003899559.1.41430 WP_003899559.1.41583 WP_003899559.1.41616 WP_003899559.1.41636 WP_003899559.1.41648 WP_003899559.1.41660 WP_003899559.1.41685 WP_003899559.1.41695 WP_003899559.1.41704 WP_003899559.1.4171 WP_003899559.1.41719 WP_003899559.1.41733 WP_003899559.1.41774 WP_003899559.1.41803 WP_003899559.1.41820 WP_003899559.1.41828 WP_003899559.1.41860 WP_003899559.1.41912 WP_003899559.1.41933 WP_003899559.1.41944 WP_003899559.1.42075 WP_003899559.1.42078 WP_003899559.1.42094 WP_003899559.1.42112 WP_003899559.1.4212 WP_003899559.1.42183 WP_003899559.1.42188 WP_003899559.1.42201 WP_003899559.1.42202 WP_003899559.1.42208 WP_003899559.1.42247 WP_003899559.1.42255 WP_003899559.1.42273 WP_003899559.1.42278 WP_003899559.1.42304 WP_003899559.1.42309 WP_003899559.1.42370 WP_003899559.1.42385 WP_003899559.1.42400 WP_003899559.1.42414 WP_003899559.1.42417 WP_003899559.1.42465 WP_003899559.1.42473 WP_003899559.1.42474 WP_003899559.1.42519 WP_003899559.1.42534 WP_003899559.1.4255 WP_003899559.1.42562 WP_003899559.1.42568 WP_003899559.1.42570 WP_003899559.1.42618 WP_003899559.1.42660 WP_003899559.1.42695 WP_003899559.1.42777 WP_003899559.1.42782 WP_003899559.1.42835 WP_003899559.1.42839 WP_003899559.1.42916 WP_003899559.1.42930 WP_003899559.1.42971 WP_003899559.1.43082 WP_003899559.1.43087 WP_003899559.1.43098 WP_003899559.1.43236 WP_003899559.1.43246 WP_003899559.1.43255 WP_003899559.1.43266 WP_003899559.1.43269 WP_003899559.1.4335 WP_003899559.1.43368 WP_003899559.1.43395 WP_003899559.1.43462 WP_003899559.1.43478 WP_003899559.1.43484 WP_003899559.1.43557 WP_003899559.1.43578 WP_003899559.1.43588 WP_003899559.1.43643 WP_003899559.1.43664 WP_003899559.1.43684 WP_003899559.1.43686 WP_003899559.1.43706 WP_003899559.1.43716 WP_003899559.1.43781 WP_003899559.1.43794 WP_003899559.1.43846 WP_003899559.1.43861 WP_003899559.1.43863 WP_003899559.1.43866 WP_003899559.1.43902 WP_003899559.1.43936 WP_003899559.1.43937 WP_003899559.1.43965 WP_003899559.1.4399 WP_003899559.1.43993 WP_003899559.1.43996 WP_003899559.1.44008 WP_003899559.1.44016 WP_003899559.1.44041 WP_003899559.1.44070 WP_003899559.1.44071 WP_003899559.1.44104 WP_003899559.1.44111 WP_003899559.1.44124 WP_003899559.1.44219 WP_003899559.1.44237 WP_003899559.1.44336 WP_003899559.1.44358 WP_003899559.1.4438 WP_003899559.1.44392 WP_003899559.1.4441 WP_003899559.1.44415 WP_003899559.1.44464 WP_003899559.1.44466 WP_003899559.1.44489 WP_003899559.1.44492 WP_003899559.1.44494 WP_003899559.1.44500 WP_003899559.1.44519 WP_003899559.1.44526 WP_003899559.1.44534 WP_003899559.1.44589 WP_003899559.1.44597 WP_003899559.1.44600 WP_003899559.1.44615 WP_003899559.1.44700 WP_003899559.1.44713 WP_003899559.1.44735 WP_003899559.1.44740 WP_003899559.1.44757 WP_003899559.1.44761 WP_003899559.1.44767 WP_003899559.1.44786 WP_003899559.1.44808 WP_003899559.1.44864 WP_003899559.1.44901 WP_003899559.1.44908 WP_003899559.1.44939 WP_003899559.1.45011 WP_003899559.1.4504 WP_003899559.1.45062 WP_003899559.1.45066 WP_003899559.1.45113 WP_003899559.1.45135 WP_003899559.1.45147 WP_003899559.1.45168 WP_003899559.1.4517 WP_003899559.1.45181 WP_003899559.1.45185 WP_003899559.1.45192 WP_003899559.1.45200 WP_003899559.1.45205 WP_003899559.1.45249 WP_003899559.1.45286 WP_003899559.1.45347 WP_003899559.1.45390 WP_003899559.1.454 WP_003899559.1.45453 WP_003899559.1.45460 WP_003899559.1.45470 WP_003899559.1.45491 WP_003899559.1.45563 WP_003899559.1.45584 WP_003899559.1.45590 WP_003899559.1.45666 WP_003899559.1.45731 WP_003899559.1.45743 WP_003899559.1.45765 WP_003899559.1.45776 WP_003899559.1.45783 WP_003899559.1.45815 WP_003899559.1.45849 WP_003899559.1.45867 WP_003899559.1.45884 WP_003899559.1.4590 WP_003899559.1.45923 WP_003899559.1.45926 WP_003899559.1.45992 WP_003899559.1.46025 WP_003899559.1.46090 WP_003899559.1.46101 WP_003899559.1.46107 WP_003899559.1.46127 WP_003899559.1.46128 WP_003899559.1.46150 WP_003899559.1.46201 WP_003899559.1.46226 WP_003899559.1.46253 WP_003899559.1.46268 WP_003899559.1.46285 WP_003899559.1.46300 WP_003899559.1.46365 WP_003899559.1.46370 WP_003899559.1.46381 WP_003899559.1.46402 WP_003899559.1.4644 WP_003899559.1.46453 WP_003899559.1.46463 WP_003899559.1.46478 WP_003899559.1.46492 WP_003899559.1.46521 WP_003899559.1.4653 WP_003899559.1.46539 WP_003899559.1.46585 WP_003899559.1.46609 WP_003899559.1.46674 WP_003899559.1.46773 WP_003899559.1.46786 WP_003899559.1.46847 WP_003899559.1.46851 WP_003899559.1.4687 WP_003899559.1.46897 WP_003899559.1.46936 WP_003899559.1.47011 WP_003899559.1.47012 WP_003899559.1.47106 WP_003899559.1.47142 WP_003899559.1.47147 WP_003899559.1.47166 WP_003899559.1.47207 WP_003899559.1.47210 WP_003899559.1.47261 WP_003899559.1.47262 WP_003899559.1.47402 WP_003899559.1.47423 WP_003899559.1.47467 WP_003899559.1.47502 WP_003899559.1.4751 WP_003899559.1.47511 WP_003899559.1.47568 WP_003899559.1.47588 WP_003899559.1.4764 WP_003899559.1.47653 WP_003899559.1.47681 WP_003899559.1.4771 WP_003899559.1.47717 WP_003899559.1.47743 WP_003899559.1.47754 WP_003899559.1.47773 WP_003899559.1.47776 WP_003899559.1.47780 WP_003899559.1.47847 WP_003899559.1.47858 WP_003899559.1.47861 WP_003899559.1.47868 WP_003899559.1.47893 WP_003899559.1.479 WP_003899559.1.47913 WP_003899559.1.4794 WP_003899559.1.47943 WP_003899559.1.47944 WP_003899559.1.48004 WP_003899559.1.48039 WP_003899559.1.48050 WP_003899559.1.48084 WP_003899559.1.48097 WP_003899559.1.48101 WP_003899559.1.48109 WP_003899559.1.4813 WP_003899559.1.48135 WP_003899559.1.48152 WP_003899559.1.48173 WP_003899559.1.48177 WP_003899559.1.48219 WP_003899559.1.4823 WP_003899559.1.48240 WP_003899559.1.48330 WP_003899559.1.48348 WP_003899559.1.48354 WP_003899559.1.48372 WP_003899559.1.48383 WP_003899559.1.48388 WP_003899559.1.48419 WP_003899559.1.48423 WP_003899559.1.48450 WP_003899559.1.48543 WP_003899559.1.48550 WP_003899559.1.48605 WP_003899559.1.4863 WP_003899559.1.48648 WP_003899559.1.48798 WP_003899559.1.48802 WP_003899559.1.48826 WP_003899559.1.48843 WP_003899559.1.48979 WP_003899559.1.49017 WP_003899559.1.49048 WP_003899559.1.4906 WP_003899559.1.4907 WP_003899559.1.49103 WP_003899559.1.49111 WP_003899559.1.49254 WP_003899559.1.49263 WP_003899559.1.49296 WP_003899559.1.49337 WP_003899559.1.49419 WP_003899559.1.49426 WP_003899559.1.49439 WP_003899559.1.49474 WP_003899559.1.49516 WP_003899559.1.49523 WP_003899559.1.49526 WP_003899559.1.49532 WP_003899559.1.49588 WP_003899559.1.49709 WP_003899559.1.4971 WP_003899559.1.4972 WP_003899559.1.49746 WP_003899559.1.49764 WP_003899559.1.49773 WP_003899559.1.49814 WP_003899559.1.49815 WP_003899559.1.49816 WP_003899559.1.49839 WP_003899559.1.49857 WP_003899559.1.49878 WP_003899559.1.49880 WP_003899559.1.49944 WP_003899559.1.50081 WP_003899559.1.50122 WP_003899559.1.50149 WP_003899559.1.5018 WP_003899559.1.50194 WP_003899559.1.50218 WP_003899559.1.50235 WP_003899559.1.50249 WP_003899559.1.50271 WP_003899559.1.50324 WP_003899559.1.50372 WP_003899559.1.50398 WP_003899559.1.50407 WP_003899559.1.50444 WP_003899559.1.50466 WP_003899559.1.50472 WP_003899559.1.50498 WP_003899559.1.5050 WP_003899559.1.50540 WP_003899559.1.50554 WP_003899559.1.50557 WP_003899559.1.50610 WP_003899559.1.50633 WP_003899559.1.50659 WP_003899559.1.50683 WP_003899559.1.50689 WP_003899559.1.50692 WP_003899559.1.50714 WP_003899559.1.50729 WP_003899559.1.50841 WP_003899559.1.50860 WP_003899559.1.50868 WP_003899559.1.5096 WP_003899559.1.50981 WP_003899559.1.50987 WP_003899559.1.51082 WP_003899559.1.51101 WP_003899559.1.51116 WP_003899559.1.51149 WP_003899559.1.51157 WP_003899559.1.51213 WP_003899559.1.51232 WP_003899559.1.51247 WP_003899559.1.51266 WP_003899559.1.51279 WP_003899559.1.51291 WP_003899559.1.51301 WP_003899559.1.51329 WP_003899559.1.51391 WP_003899559.1.51422 WP_003899559.1.51468 WP_003899559.1.51478 WP_003899559.1.51520 WP_003899559.1.51593 WP_003899559.1.51628 WP_003899559.1.5164 WP_003899559.1.51647 WP_003899559.1.51660 WP_003899559.1.51721 WP_003899559.1.51801 WP_003899559.1.51817 WP_003899559.1.51819 WP_003899559.1.51854 WP_003899559.1.51923 WP_003899559.1.51942 WP_003899559.1.51948 WP_003899559.1.51963 WP_003899559.1.51969 WP_003899559.1.52000 WP_003899559.1.52001 WP_003899559.1.52036 WP_003899559.1.52038 WP_003899559.1.52046 WP_003899559.1.52059 WP_003899559.1.52069 WP_003899559.1.52106 WP_003899559.1.52166 WP_003899559.1.52168 WP_003899559.1.52173 WP_003899559.1.52216 WP_003899559.1.52238 WP_003899559.1.52241 WP_003899559.1.52280 WP_003899559.1.52314 WP_003899559.1.52385 WP_003899559.1.52485 WP_003899559.1.52486 WP_003899559.1.52495 WP_003899559.1.52504 WP_003899559.1.52522 WP_003899559.1.52531 WP_003899559.1.52563 WP_003899559.1.52564 WP_003899559.1.52673 WP_003899559.1.52674 WP_003899559.1.52713 WP_003899559.1.52761 WP_003899559.1.52778 WP_003899559.1.52791 WP_003899559.1.52797 WP_003899559.1.52818 WP_003899559.1.52873 WP_003899559.1.52909 WP_003899559.1.52998 WP_003899559.1.53056 WP_003899559.1.5306 WP_003899559.1.53088 WP_003899559.1.53117 WP_003899559.1.53118 WP_003899559.1.53142 WP_003899559.1.53167 WP_003899559.1.53200 WP_003899559.1.53204 WP_003899559.1.53226 WP_003899559.1.53230 WP_003899559.1.53237 WP_003899559.1.5327 WP_003899559.1.53276 WP_003899559.1.53302 WP_003899559.1.53306 WP_003899559.1.5334 WP_003899559.1.5335 WP_003899559.1.53413 WP_003899559.1.53458 WP_003899559.1.53460 WP_003899559.1.53522 WP_003899559.1.53525 WP_003899559.1.53526 WP_003899559.1.53553 WP_003899559.1.53609 WP_003899559.1.53628 WP_003899559.1.53643 WP_003899559.1.53667 WP_003899559.1.53679 WP_003899559.1.53715 WP_003899559.1.53742 WP_003899559.1.53743 WP_003899559.1.53787 WP_003899559.1.53818 WP_003899559.1.53822 WP_003899559.1.53853 WP_003899559.1.53865 WP_003899559.1.53912 WP_003899559.1.53914 WP_003899559.1.5398 WP_003899559.1.54089 WP_003899559.1.54093 WP_003899559.1.54099 WP_003899559.1.54112 WP_003899559.1.54141 WP_003899559.1.54218 WP_003899559.1.54225 WP_003899559.1.54227 WP_003899559.1.54232 WP_003899559.1.54241 WP_003899559.1.54247 WP_003899559.1.54260 WP_003899559.1.54280 WP_003899559.1.5429 WP_003899559.1.54294 WP_003899559.1.54314 WP_003899559.1.54347 WP_003899559.1.54370 WP_003899559.1.54428 WP_003899559.1.54449 WP_003899559.1.54494 WP_003899559.1.54502 WP_003899559.1.54514 WP_003899559.1.54519 WP_003899559.1.5452 WP_003899559.1.54555 WP_003899559.1.54575 WP_003899559.1.54686 WP_003899559.1.54687 WP_003899559.1.54730 WP_003899559.1.5475 WP_003899559.1.54797 WP_003899559.1.54807 WP_003899559.1.54838 WP_003899559.1.54897 WP_003899559.1.54939 WP_003899559.1.54944 WP_003899559.1.54945 WP_003899559.1.55015 WP_003899559.1.55022 WP_003899559.1.55051 WP_003899559.1.55072 WP_003899559.1.55088 WP_003899559.1.55106 WP_003899559.1.55126 WP_003899559.1.55150 WP_003899559.1.55248 WP_003899559.1.55258 WP_003899559.1.55267 WP_003899559.1.55279 WP_003899559.1.55326 WP_003899559.1.5533 WP_003899559.1.55345 WP_003899559.1.55396 WP_003899559.1.55398 WP_003899559.1.55441 WP_003899559.1.55459 WP_003899559.1.55501 WP_003899559.1.55504 WP_003899559.1.55641 WP_003899559.1.5569 WP_003899559.1.55735 WP_003899559.1.55772 WP_003899559.1.55802 WP_003899559.1.55807 WP_003899559.1.55821 WP_003899559.1.5583 WP_003899559.1.55856 WP_003899559.1.55883 WP_003899559.1.55902 WP_003899559.1.5591 WP_003899559.1.55961 WP_003899559.1.55977 WP_003899559.1.55983 WP_003899559.1.56028 WP_003899559.1.56057 WP_003899559.1.56060 WP_003899559.1.56107 WP_003899559.1.56132 WP_003899559.1.56163 WP_003899559.1.56167 WP_003899559.1.56287 WP_003899559.1.56327 WP_003899559.1.56359 WP_003899559.1.56394 WP_003899559.1.56443 WP_003899559.1.56473 WP_003899559.1.56500 WP_003899559.1.56517 WP_003899559.1.56534 WP_003899559.1.5656 WP_003899559.1.56593 WP_003899559.1.56625 WP_003899559.1.56637 WP_003899559.1.56670 WP_003899559.1.56697 WP_003899559.1.56709 WP_003899559.1.56729 WP_003899559.1.56755 WP_003899559.1.56764 WP_003899559.1.56769 WP_003899559.1.56770 WP_003899559.1.56795 WP_003899559.1.5681 WP_003899559.1.56827 WP_003899559.1.56839 WP_003899559.1.56868 WP_003899559.1.56915 WP_003899559.1.56961 WP_003899559.1.56971 WP_003899559.1.56972 WP_003899559.1.57035 WP_003899559.1.57077 WP_003899559.1.57087 WP_003899559.1.57094 WP_003899559.1.57151 WP_003899559.1.57169 WP_003899559.1.57208 WP_003899559.1.57212 WP_003899559.1.57230 WP_003899559.1.5725 WP_003899559.1.5727 WP_003899559.1.57273 WP_003899559.1.573 WP_003899559.1.57351 WP_003899559.1.57352 WP_003899559.1.57380 WP_003899559.1.57430 WP_003899559.1.5744 WP_003899559.1.5745 WP_003899559.1.57461 WP_003899559.1.57469 WP_003899559.1.57509 WP_003899559.1.57525 WP_003899559.1.57551 WP_003899559.1.5758 WP_003899559.1.57596 WP_003899559.1.57604 WP_003899559.1.57616 WP_003899559.1.57617 WP_003899559.1.57619 WP_003899559.1.57642 WP_003899559.1.57658 WP_003899559.1.57667 WP_003899559.1.57675 WP_003899559.1.57689 WP_003899559.1.57708 WP_003899559.1.57794 WP_003899559.1.57843 WP_003899559.1.57906 WP_003899559.1.57926 WP_003899559.1.57930 WP_003899559.1.57957 WP_003899559.1.57960 WP_003899559.1.57964 WP_003899559.1.58000 WP_003899559.1.58086 WP_003899559.1.58101 WP_003899559.1.58108 WP_003899559.1.58121 WP_003899559.1.58164 WP_003899559.1.582 WP_003899559.1.58202 WP_003899559.1.5824 WP_003899559.1.58259 WP_003899559.1.58283 WP_003899559.1.58288 WP_003899559.1.5830 WP_003899559.1.58303 WP_003899559.1.58311 WP_003899559.1.58359 WP_003899559.1.58431 WP_003899559.1.58488 WP_003899559.1.58518 WP_003899559.1.58534 WP_003899559.1.58567 WP_003899559.1.58573 WP_003899559.1.58602 WP_003899559.1.5865 WP_003899559.1.58671 WP_003899559.1.58690 WP_003899559.1.58702 WP_003899559.1.58743 WP_003899559.1.58754 WP_003899559.1.5881 WP_003899559.1.58848 WP_003899559.1.58857 WP_003899559.1.58891 WP_003899559.1.58892 WP_003899559.1.5890 WP_003899559.1.58921 WP_003899559.1.58939 WP_003899559.1.58941 WP_003899559.1.58953 WP_003899559.1.5898 WP_003899559.1.59025 WP_003899559.1.59029 WP_003899559.1.59037 WP_003899559.1.59044 WP_003899559.1.59085 WP_003899559.1.59088 WP_003899559.1.59130 WP_003899559.1.5914 WP_003899559.1.59147 WP_003899559.1.59209 WP_003899559.1.59240 WP_003899559.1.59253 WP_003899559.1.59254 WP_003899559.1.59262 WP_003899559.1.5928 WP_003899559.1.59304 WP_003899559.1.59316 WP_003899559.1.59326 WP_003899559.1.59328 WP_003899559.1.59338 WP_003899559.1.59388 WP_003899559.1.59428 WP_003899559.1.59537 WP_003899559.1.59677 WP_003899559.1.59738 WP_003899559.1.59757 WP_003899559.1.59808 WP_003899559.1.59850 WP_003899559.1.59856 WP_003899559.1.59861 WP_003899559.1.59878 WP_003899559.1.59888 WP_003899559.1.5996 WP_003899559.1.59961 WP_003899559.1.60007 WP_003899559.1.60016 WP_003899559.1.6003 WP_003899559.1.60047 WP_003899559.1.6007 WP_003899559.1.60091 WP_003899559.1.60121 WP_003899559.1.60135 WP_003899559.1.60139 WP_003899559.1.60152 WP_003899559.1.60205 WP_003899559.1.60215 WP_003899559.1.60267 WP_003899559.1.60288 WP_003899559.1.60291 WP_003899559.1.60301 WP_003899559.1.60305 WP_003899559.1.60312 WP_003899559.1.60313 WP_003899559.1.60314 WP_003899559.1.60421 WP_003899559.1.60451 WP_003899559.1.60460 WP_003899559.1.60479 WP_003899559.1.60487 WP_003899559.1.60512 WP_003899559.1.60583 WP_003899559.1.60632 WP_003899559.1.60657 WP_003899559.1.60687 WP_003899559.1.60689 WP_003899559.1.60727 WP_003899559.1.60738 WP_003899559.1.60763 WP_003899559.1.60791 WP_003899559.1.60834 WP_003899559.1.60870 WP_003899559.1.60878 WP_003899559.1.60879 WP_003899559.1.60913 WP_003899559.1.61001 WP_003899559.1.61012 WP_003899559.1.61052 WP_003899559.1.61065 WP_003899559.1.61100 WP_003899559.1.61101 WP_003899559.1.61142 WP_003899559.1.61198 WP_003899559.1.612 WP_003899559.1.61234 WP_003899559.1.61256 WP_003899559.1.61281 WP_003899559.1.61368 WP_003899559.1.61409 WP_003899559.1.61420 WP_003899559.1.61422 WP_003899559.1.61428 WP_003899559.1.61469 WP_003899559.1.61494 WP_003899559.1.61522 WP_003899559.1.61567 WP_003899559.1.61573 WP_003899559.1.61584 WP_003899559.1.61586 WP_003899559.1.6159 WP_003899559.1.61592 WP_003899559.1.6160 WP_003899559.1.61614 WP_003899559.1.6163 WP_003899559.1.61655 WP_003899559.1.61682 WP_003899559.1.61692 WP_003899559.1.61728 WP_003899559.1.61750 WP_003899559.1.61754 WP_003899559.1.61755 WP_003899559.1.61757 WP_003899559.1.61778 WP_003899559.1.61793 WP_003899559.1.61816 WP_003899559.1.61842 WP_003899559.1.61850 WP_003899559.1.61868 WP_003899559.1.61911 WP_003899559.1.61925 WP_003899559.1.61941 WP_003899559.1.61953 WP_003899559.1.61979 WP_003899559.1.61986 WP_003899559.1.61998 WP_003899559.1.62021 WP_003899559.1.62087 WP_003899559.1.62089 WP_003899559.1.62104 WP_003899559.1.6211 WP_003899559.1.62162 WP_003899559.1.62225 WP_003899559.1.62249 WP_003899559.1.62270 WP_003899559.1.62281 WP_003899559.1.62307 WP_003899559.1.6231 WP_003899559.1.62359 WP_003899559.1.62360 WP_003899559.1.62371 WP_003899559.1.62379 WP_003899559.1.62395 WP_003899559.1.62408 WP_003899559.1.62449 WP_003899559.1.62468 WP_003899559.1.62508 WP_003899559.1.62565 WP_003899559.1.62616 WP_003899559.1.62687 WP_003899559.1.62715 WP_003899559.1.62738 WP_003899559.1.62761 WP_003899559.1.62786 WP_003899559.1.62813 WP_003899559.1.62839 WP_003899559.1.62909 WP_003899559.1.6294 WP_003899559.1.6295 WP_003899559.1.62962 WP_003899559.1.63007 WP_003899559.1.63019 WP_003899559.1.63032 WP_003899559.1.63064 WP_003899559.1.63066 WP_003899559.1.63072 WP_003899559.1.6308 WP_003899559.1.63081 WP_003899559.1.63096 WP_003899559.1.63106 WP_003899559.1.6314 WP_003899559.1.63154 WP_003899559.1.63166 WP_003899559.1.6322 WP_003899559.1.63222 WP_003899559.1.63247 WP_003899559.1.6328 WP_003899559.1.63291 WP_003899559.1.63317 WP_003899559.1.63373 WP_003899559.1.63384 WP_003899559.1.63403 WP_003899559.1.63424 WP_003899559.1.63428 WP_003899559.1.63464 WP_003899559.1.63502 WP_003899559.1.63504 WP_003899559.1.63538 WP_003899559.1.63564 WP_003899559.1.63567 WP_003899559.1.63596 WP_003899559.1.63627 WP_003899559.1.63654 WP_003899559.1.63662 WP_003899559.1.63819 WP_003899559.1.63844 WP_003899559.1.63915 WP_003899559.1.63918 WP_003899559.1.63961 WP_003899559.1.64000 WP_003899559.1.64027 WP_003899559.1.64082 WP_003899559.1.64091 WP_003899559.1.64102 WP_003899559.1.64104 WP_003899559.1.64119 WP_003899559.1.64219 WP_003899559.1.6422 WP_003899559.1.64222 WP_003899559.1.64223 WP_003899559.1.64228 WP_003899559.1.64235 WP_003899559.1.6427 WP_003899559.1.64278 WP_003899559.1.64414 WP_003899559.1.64419 WP_003899559.1.6443 WP_003899559.1.64463 WP_003899559.1.64506 WP_003899559.1.64513 WP_003899559.1.64514 WP_003899559.1.64515 WP_003899559.1.64522 WP_003899559.1.64526 WP_003899559.1.64543 WP_003899559.1.6456 WP_003899559.1.64567 WP_003899559.1.64588 WP_003899559.1.64589 WP_003899559.1.64594 WP_003899559.1.64595 WP_003899559.1.64608 WP_003899559.1.6464 WP_003899559.1.64664 WP_003899559.1.64669 WP_003899559.1.64672 WP_003899559.1.64680 WP_003899559.1.64682 WP_003899559.1.64727 WP_003899559.1.64729 WP_003899559.1.64774 WP_003899559.1.64802 WP_003899559.1.6486 WP_003899559.1.64870 WP_003899559.1.64898 WP_003899559.1.64924 WP_003899559.1.6493 WP_003899559.1.64937 WP_003899559.1.64941 WP_003899559.1.64966 WP_003899559.1.64973 WP_003899559.1.65001 WP_003899559.1.65026 WP_003899559.1.65053 WP_003899559.1.65102 WP_003899559.1.65157 WP_003899559.1.65181 WP_003899559.1.65212 WP_003899559.1.65229 WP_003899559.1.6523 WP_003899559.1.65253 WP_003899559.1.65329 WP_003899559.1.6536 WP_003899559.1.65374 WP_003899559.1.65386 WP_003899559.1.65433 WP_003899559.1.65455 WP_003899559.1.65467 WP_003899559.1.65488 WP_003899559.1.65583 WP_003899559.1.65623 WP_003899559.1.65635 WP_003899559.1.65648 WP_003899559.1.65683 WP_003899559.1.65686 WP_003899559.1.65688 WP_003899559.1.65707 WP_003899559.1.65747 WP_003899559.1.65816 WP_003899559.1.65830 WP_003899559.1.65862 WP_003899559.1.65929 WP_003899559.1.65974 WP_003899559.1.66004 WP_003899559.1.66013 WP_003899559.1.66089 WP_003899559.1.66149 WP_003899559.1.66229 WP_003899559.1.66276 WP_003899559.1.66293 WP_003899559.1.66297 WP_003899559.1.66323 WP_003899559.1.66325 WP_003899559.1.66355 WP_003899559.1.66394 WP_003899559.1.66455 WP_003899559.1.66460 WP_003899559.1.66464 WP_003899559.1.66466 WP_003899559.1.66487 WP_003899559.1.66558 WP_003899559.1.66580 WP_003899559.1.66612 WP_003899559.1.66615 WP_003899559.1.66656 WP_003899559.1.66663 WP_003899559.1.66675 WP_003899559.1.66715 WP_003899559.1.66718 WP_003899559.1.66817 WP_003899559.1.66826 WP_003899559.1.66868 WP_003899559.1.66878 WP_003899559.1.66880 WP_003899559.1.66961 WP_003899559.1.67005 WP_003899559.1.6704 WP_003899559.1.67061 WP_003899559.1.67098 WP_003899559.1.67146 WP_003899559.1.67170 WP_003899559.1.67198 WP_003899559.1.6720 WP_003899559.1.67220 WP_003899559.1.67225 WP_003899559.1.67231 WP_003899559.1.6724 WP_003899559.1.67257 WP_003899559.1.67298 WP_003899559.1.67307 WP_003899559.1.67332 WP_003899559.1.67346 WP_003899559.1.67354 WP_003899559.1.67360 WP_003899559.1.67381 WP_003899559.1.67396 WP_003899559.1.67417 WP_003899559.1.67422 WP_003899559.1.67459 WP_003899559.1.6746 WP_003899559.1.67473 WP_003899559.1.67481 WP_003899559.1.67482 WP_003899559.1.67496 WP_003899559.1.67516 WP_003899559.1.67523 WP_003899559.1.67536 WP_003899559.1.67575 WP_003899559.1.67598 WP_003899559.1.67600 WP_003899559.1.67602 WP_003899559.1.67692 WP_003899559.1.67744 WP_003899559.1.6775 WP_003899559.1.67750 WP_003899559.1.6777 WP_003899559.1.67809 WP_003899559.1.67848 WP_003899559.1.67870 WP_003899559.1.67888 WP_003899559.1.67915 WP_003899559.1.67980 WP_003899559.1.67982 WP_003899559.1.68029 WP_003899559.1.68057 WP_003899559.1.68083 WP_003899559.1.68088 WP_003899559.1.68164 WP_003899559.1.68169 WP_003899559.1.68193 WP_003899559.1.68212 WP_003899559.1.68227 WP_003899559.1.6825 WP_003899559.1.68297 WP_003899559.1.68325 WP_003899559.1.68340 WP_003899559.1.68384 WP_003899559.1.68388 WP_003899559.1.68429 WP_003899559.1.6843 WP_003899559.1.68433 WP_003899559.1.68465 WP_003899559.1.68484 WP_003899559.1.68518 WP_003899559.1.68569 WP_003899559.1.68576 WP_003899559.1.68580 WP_003899559.1.68623 WP_003899559.1.68624 WP_003899559.1.68637 WP_003899559.1.68646 WP_003899559.1.68667 WP_003899559.1.68669 WP_003899559.1.68672 WP_003899559.1.68704 WP_003899559.1.68708 WP_003899559.1.68730 WP_003899559.1.68734 WP_003899559.1.68748 WP_003899559.1.68754 WP_003899559.1.6876 WP_003899559.1.68761 WP_003899559.1.68763 WP_003899559.1.68766 WP_003899559.1.68774 WP_003899559.1.68796 WP_003899559.1.68824 WP_003899559.1.68832 WP_003899559.1.68833 WP_003899559.1.68841 WP_003899559.1.68859 WP_003899559.1.68876 WP_003899559.1.68916 WP_003899559.1.68923 WP_003899559.1.68945 WP_003899559.1.6896 WP_003899559.1.68981 WP_003899559.1.68984 WP_003899559.1.69008 WP_003899559.1.69076 WP_003899559.1.69079 WP_003899559.1.69082 WP_003899559.1.69178 WP_003899559.1.69181 WP_003899559.1.69231 WP_003899559.1.69256 WP_003899559.1.69311 WP_003899559.1.69315 WP_003899559.1.69322 WP_003899559.1.69342 WP_003899559.1.6935 WP_003899559.1.6936 WP_003899559.1.69426 WP_003899559.1.69427 WP_003899559.1.69429 WP_003899559.1.6951 WP_003899559.1.69511 WP_003899559.1.69526 WP_003899559.1.69547 WP_003899559.1.69573 WP_003899559.1.6960 WP_003899559.1.69617 WP_003899559.1.69634 WP_003899559.1.69647 WP_003899559.1.69659 WP_003899559.1.69673 WP_003899559.1.69684 WP_003899559.1.69686 WP_003899559.1.69707 WP_003899559.1.69709 WP_003899559.1.69723 WP_003899559.1.69800 WP_003899559.1.69802 WP_003899559.1.69870 WP_003899559.1.69873 WP_003899559.1.69898 WP_003899559.1.69913 WP_003899559.1.69925 WP_003899559.1.69931 WP_003899559.1.69938 WP_003899559.1.69955 WP_003899559.1.69957 WP_003899559.1.69981 WP_003899559.1.69990 WP_003899559.1.70032 WP_003899559.1.70062 WP_003899559.1.70072 WP_003899559.1.70131 WP_003899559.1.70132 WP_003899559.1.7022 WP_003899559.1.70227 WP_003899559.1.70274 WP_003899559.1.70325 WP_003899559.1.70328 WP_003899559.1.70356 WP_003899559.1.70369 WP_003899559.1.70418 WP_003899559.1.70422 WP_003899559.1.70435 WP_003899559.1.70463 WP_003899559.1.70480 WP_003899559.1.70494 WP_003899559.1.70498 WP_003899559.1.70505 WP_003899559.1.70525 WP_003899559.1.70573 WP_003899559.1.70577 WP_003899559.1.70610 WP_003899559.1.70615 WP_003899559.1.70618 WP_003899559.1.70622 WP_003899559.1.70626 WP_003899559.1.70704 WP_003899559.1.70729 WP_003899559.1.70782 WP_003899559.1.70796 WP_003899559.1.70830 WP_003899559.1.70840 WP_003899559.1.70871 WP_003899559.1.70915 WP_003899559.1.70955 WP_003899559.1.70958 WP_003899559.1.70964 WP_003899559.1.70976 WP_003899559.1.71026 WP_003899559.1.71063 WP_003899559.1.71076 WP_003899559.1.7111 WP_003899559.1.71128 WP_003899559.1.71187 WP_003899559.1.71258 WP_003899559.1.71259 WP_003899559.1.71289 WP_003899559.1.71326 WP_003899559.1.71329 WP_003899559.1.71331 WP_003899559.1.71344 WP_003899559.1.71390 WP_003899559.1.71399 WP_003899559.1.71440 WP_003899559.1.71457 WP_003899559.1.7146 WP_003899559.1.71490 WP_003899559.1.71492 WP_003899559.1.71509 WP_003899559.1.71516 WP_003899559.1.71517 WP_003899559.1.71527 WP_003899559.1.71532 WP_003899559.1.71545 WP_003899559.1.71546 WP_003899559.1.71569 WP_003899559.1.71604 WP_003899559.1.71621 WP_003899559.1.71630 WP_003899559.1.71638 WP_003899559.1.71654 WP_003899559.1.71664 WP_003899559.1.71683 WP_003899559.1.71718 WP_003899559.1.71781 WP_003899559.1.71820 WP_003899559.1.71847 WP_003899559.1.71871 WP_003899559.1.71909 WP_003899559.1.71957 WP_003899559.1.71970 WP_003899559.1.72047 WP_003899559.1.72061 WP_003899559.1.72111 WP_003899559.1.72122 WP_003899559.1.72128 WP_003899559.1.72143 WP_003899559.1.7216 WP_003899559.1.72209 WP_003899559.1.72218 WP_003899559.1.72219 WP_003899559.1.72227 WP_003899559.1.7224 WP_003899559.1.72332 WP_003899559.1.72380 WP_003899559.1.72405 WP_003899559.1.72420 WP_003899559.1.72451 WP_003899559.1.72457 WP_003899559.1.72459 WP_003899559.1.72466 WP_003899559.1.72487 WP_003899559.1.72506 WP_003899559.1.72543 WP_003899559.1.7256 WP_003899559.1.72585 WP_003899559.1.72591 WP_003899559.1.72592 WP_003899559.1.72640 WP_003899559.1.7266 WP_003899559.1.72684 WP_003899559.1.72739 WP_003899559.1.72744 WP_003899559.1.72755 WP_003899559.1.72759 WP_003899559.1.72784 WP_003899559.1.72792 WP_003899559.1.72826 WP_003899559.1.72831 WP_003899559.1.72852 WP_003899559.1.72879 WP_003899559.1.72880 WP_003899559.1.72954 WP_003899559.1.72957 WP_003899559.1.72959 WP_003899559.1.72973 WP_003899559.1.7298 WP_003899559.1.72982 WP_003899559.1.72988 WP_003899559.1.72993 WP_003899559.1.73028 WP_003899559.1.73042 WP_003899559.1.73092 WP_003899559.1.73118 WP_003899559.1.7312 WP_003899559.1.73127 WP_003899559.1.73150 WP_003899559.1.73163 WP_003899559.1.73205 WP_003899559.1.73310 WP_003899559.1.73391 WP_003899559.1.73404 WP_003899559.1.73424 WP_003899559.1.73445 WP_003899559.1.73465 WP_003899559.1.73466 WP_003899559.1.73471 WP_003899559.1.73478 WP_003899559.1.73482 WP_003899559.1.73507 WP_003899559.1.73532 WP_003899559.1.73550 WP_003899559.1.73564 WP_003899559.1.73623 WP_003899559.1.73644 WP_003899559.1.73688 WP_003899559.1.73744 WP_003899559.1.73750 WP_003899559.1.73760 WP_003899559.1.73774 WP_003899559.1.7379 WP_003899559.1.73813 WP_003899559.1.73840 WP_003899559.1.73876 WP_003899559.1.7389 WP_003899559.1.73986 WP_003899559.1.74016 WP_003899559.1.74039 WP_003899559.1.74083 WP_003899559.1.74107 WP_003899559.1.74120 WP_003899559.1.74144 WP_003899559.1.7417 WP_003899559.1.74190 WP_003899559.1.7423 WP_003899559.1.74259 WP_003899559.1.74262 WP_003899559.1.74269 WP_003899559.1.74291 WP_003899559.1.74296 WP_003899559.1.7436 WP_003899559.1.74378 WP_003899559.1.74395 WP_003899559.1.74400 WP_003899559.1.74401 WP_003899559.1.74432 WP_003899559.1.74477 WP_003899559.1.74504 WP_003899559.1.74555 WP_003899559.1.74628 WP_003899559.1.74641 WP_003899559.1.74653 WP_003899559.1.74660 WP_003899559.1.74786 WP_003899559.1.74820 WP_003899559.1.74870 WP_003899559.1.74881 WP_003899559.1.74888 WP_003899559.1.75043 WP_003899559.1.75045 WP_003899559.1.75055 WP_003899559.1.75078 WP_003899559.1.75081 WP_003899559.1.75120 WP_003899559.1.75163 WP_003899559.1.75188 WP_003899559.1.75200 WP_003899559.1.75239 WP_003899559.1.75250 WP_003899559.1.75263 WP_003899559.1.75281 WP_003899559.1.7535 WP_003899559.1.75376 WP_003899559.1.75391 WP_003899559.1.75441 WP_003899559.1.75581 WP_003899559.1.75635 WP_003899559.1.75645 WP_003899559.1.75665 WP_003899559.1.75741 WP_003899559.1.75772 WP_003899559.1.75774 WP_003899559.1.75811 WP_003899559.1.75833 WP_003899559.1.7585 WP_003899559.1.75864 WP_003899559.1.75868 WP_003899559.1.75968 WP_003899559.1.75974 WP_003899559.1.76007 WP_003899559.1.76016 WP_003899559.1.76032 WP_003899559.1.76037 WP_003899559.1.7604 WP_003899559.1.76064 WP_003899559.1.76110 WP_003899559.1.76172 WP_003899559.1.76177 WP_003899559.1.76183 WP_003899559.1.76239 WP_003899559.1.76272 WP_003899559.1.76280 WP_003899559.1.76281 WP_003899559.1.76291 WP_003899559.1.76297 WP_003899559.1.76360 WP_003899559.1.76379 WP_003899559.1.76403 WP_003899559.1.76414 WP_003899559.1.76427 WP_003899559.1.76436 WP_003899559.1.76442 WP_003899559.1.76443 WP_003899559.1.76456 WP_003899559.1.76533 WP_003899559.1.76625 WP_003899559.1.76629 WP_003899559.1.76635 WP_003899559.1.76638 WP_003899559.1.76639 WP_003899559.1.76678 WP_003899559.1.76679 WP_003899559.1.76781 WP_003899559.1.76818 WP_003899559.1.76824 WP_003899559.1.76835 WP_003899559.1.76873 WP_003899559.1.76881 WP_003899559.1.76900 WP_003899559.1.7691 WP_003899559.1.76947 WP_003899559.1.76954 WP_003899559.1.76955 WP_003899559.1.76976 WP_003899559.1.77000 WP_003899559.1.77021 WP_003899559.1.77056 WP_003899559.1.77065 WP_003899559.1.77075 WP_003899559.1.77093 WP_003899559.1.77107 WP_003899559.1.77115 WP_003899559.1.77118 WP_003899559.1.77141 WP_003899559.1.77142 WP_003899559.1.77166 WP_003899559.1.77250 WP_003899559.1.77252 WP_003899559.1.77260 WP_003899559.1.77266 WP_003899559.1.77280 WP_003899559.1.77285 WP_003899559.1.77312 WP_003899559.1.77348 WP_003899559.1.77351 WP_003899559.1.77352 WP_003899559.1.77361 WP_003899559.1.774 WP_003899559.1.7740 WP_003899559.1.77425 WP_003899559.1.77463 WP_003899559.1.7748 WP_003899559.1.77484 WP_003899559.1.77599 WP_003899559.1.77605 WP_003899559.1.7762 WP_003899559.1.77627 WP_003899559.1.77649 WP_003899559.1.77654 WP_003899559.1.77667 WP_003899559.1.77704 WP_003899559.1.77726 WP_003899559.1.77774 WP_003899559.1.7778 WP_003899559.1.77790 WP_003899559.1.77809 WP_003899559.1.77843 WP_003899559.1.77865 WP_003899559.1.77879 WP_003899559.1.77909 WP_003899559.1.77931 WP_003899559.1.77984 WP_003899559.1.78020 WP_003899559.1.78024 WP_003899559.1.78084 WP_003899559.1.78086 WP_003899559.1.7809 WP_003899559.1.78105 WP_003899559.1.78136 WP_003899559.1.78162 WP_003899559.1.7817 WP_003899559.1.78236 WP_003899559.1.78322 WP_003899559.1.78338 WP_003899559.1.7836 WP_003899559.1.78360 WP_003899559.1.78429 WP_003899559.1.78459 WP_003899559.1.78488 WP_003899559.1.7849 WP_003899559.1.78516 WP_003899559.1.78524 WP_003899559.1.78544 WP_003899559.1.78545 WP_003899559.1.78574 WP_003899559.1.78580 WP_003899559.1.7860 WP_003899559.1.78620 WP_003899559.1.78648 WP_003899559.1.78655 WP_003899559.1.78657 WP_003899559.1.78659 WP_003899559.1.7869 WP_003899559.1.78692 WP_003899559.1.78760 WP_003899559.1.78766 WP_003899559.1.78776 WP_003899559.1.78778 WP_003899559.1.78784 WP_003899559.1.78788 WP_003899559.1.78790 WP_003899559.1.78793 WP_003899559.1.78848 WP_003899559.1.78860 WP_003899559.1.7887 WP_003899559.1.78884 WP_003899559.1.78977 WP_003899559.1.79033 WP_003899559.1.79064 WP_003899559.1.79068 WP_003899559.1.79077 WP_003899559.1.79112 WP_003899559.1.79145 WP_003899559.1.79152 WP_003899559.1.79163 WP_003899559.1.79182 WP_003899559.1.79198 WP_003899559.1.79218 WP_003899559.1.79273 WP_003899559.1.79290 WP_003899559.1.79319 WP_003899559.1.79326 WP_003899559.1.79394 WP_003899559.1.79413 WP_003899559.1.79422 WP_003899559.1.79447 WP_003899559.1.79455 WP_003899559.1.79480 WP_003899559.1.79482 WP_003899559.1.79488 WP_003899559.1.79500 WP_003899559.1.79565 WP_003899559.1.79588 WP_003899559.1.79698 WP_003899559.1.797 WP_003899559.1.79744 WP_003899559.1.79784 WP_003899559.1.79802 WP_003899559.1.79806 WP_003899559.1.79819 WP_003899559.1.79828 WP_003899559.1.79851 WP_003899559.1.79853 WP_003899559.1.79881 WP_003899559.1.7990 WP_003899559.1.79913 WP_003899559.1.79918 WP_003899559.1.79947 WP_003899559.1.79948 WP_003899559.1.7995 WP_003899559.1.7997 WP_003899559.1.80004 WP_003899559.1.80015 WP_003899559.1.80054 WP_003899559.1.80084 WP_003899559.1.8026 WP_003899559.1.80275 WP_003899559.1.80299 WP_003899559.1.80300 WP_003899559.1.80351 WP_003899559.1.80370 WP_003899559.1.80387 WP_003899559.1.80399 WP_003899559.1.80451 WP_003899559.1.80458 WP_003899559.1.80461 WP_003899559.1.80490 WP_003899559.1.80503 WP_003899559.1.80552 WP_003899559.1.80576 WP_003899559.1.80588 WP_003899559.1.80599 WP_003899559.1.8060 WP_003899559.1.80624 WP_003899559.1.80636 WP_003899559.1.80673 WP_003899559.1.80711 WP_003899559.1.80714 WP_003899559.1.80815 WP_003899559.1.80853 WP_003899559.1.80918 WP_003899559.1.80967 WP_003899559.1.8097 WP_003899559.1.80988 WP_003899559.1.81013 WP_003899559.1.81059 WP_003899559.1.81066 WP_003899559.1.81075 WP_003899559.1.81091 WP_003899559.1.81136 WP_003899559.1.8114 WP_003899559.1.81189 WP_003899559.1.81192 WP_003899559.1.81230 WP_003899559.1.81249 WP_003899559.1.81250 WP_003899559.1.8128 WP_003899559.1.81287 WP_003899559.1.81407 WP_003899559.1.81439 WP_003899559.1.81465 WP_003899559.1.81505 WP_003899559.1.81529 WP_003899559.1.81538 WP_003899559.1.81541 WP_003899559.1.81561 WP_003899559.1.81567 WP_003899559.1.81686 WP_003899559.1.81720 WP_003899559.1.81731 WP_003899559.1.81774 WP_003899559.1.81788 WP_003899559.1.81809 WP_003899559.1.81820 WP_003899559.1.81850 WP_003899559.1.81883 WP_003899559.1.81891 WP_003899559.1.82011 WP_003899559.1.82048 WP_003899559.1.82142 WP_003899559.1.8215 WP_003899559.1.8217 WP_003899559.1.82209 WP_003899559.1.82210 WP_003899559.1.82228 WP_003899559.1.82251 WP_003899559.1.82346 WP_003899559.1.82385 WP_003899559.1.82462 WP_003899559.1.82483 WP_003899559.1.82531 WP_003899559.1.82546 WP_003899559.1.82547 WP_003899559.1.82549 WP_003899559.1.82592 WP_003899559.1.82598 WP_003899559.1.82642 WP_003899559.1.82681 WP_003899559.1.8273 WP_003899559.1.82774 WP_003899559.1.82803 WP_003899559.1.82836 WP_003899559.1.82860 WP_003899559.1.82935 WP_003899559.1.82957 WP_003899559.1.82973 WP_003899559.1.82981 WP_003899559.1.82983 WP_003899559.1.83009 WP_003899559.1.83110 WP_003899559.1.83146 WP_003899559.1.83149 WP_003899559.1.83159 WP_003899559.1.83173 WP_003899559.1.83181 WP_003899559.1.83197 WP_003899559.1.83212 WP_003899559.1.83262 WP_003899559.1.83268 WP_003899559.1.83273 WP_003899559.1.83332 WP_003899559.1.83334 WP_003899559.1.83341 WP_003899559.1.83367 WP_003899559.1.83380 WP_003899559.1.83409 WP_003899559.1.83435 WP_003899559.1.83470 WP_003899559.1.83524 WP_003899559.1.83526 WP_003899559.1.8358 WP_003899559.1.83601 WP_003899559.1.83648 WP_003899559.1.83656 WP_003899559.1.83692 WP_003899559.1.83705 WP_003899559.1.83766 WP_003899559.1.83793 WP_003899559.1.83794 WP_003899559.1.83805 WP_003899559.1.83842 WP_003899559.1.83850 WP_003899559.1.83861 WP_003899559.1.83884 WP_003899559.1.83930 WP_003899559.1.83975 WP_003899559.1.84027 WP_003899559.1.8404 WP_003899559.1.84070 WP_003899559.1.8409 WP_003899559.1.8415 WP_003899559.1.84176 WP_003899559.1.84186 WP_003899559.1.84192 WP_003899559.1.84259 WP_003899559.1.8426 WP_003899559.1.84277 WP_003899559.1.84287 WP_003899559.1.8434 WP_003899559.1.84408 WP_003899559.1.84409 WP_003899559.1.84488 WP_003899559.1.84525 WP_003899559.1.84620 WP_003899559.1.84623 WP_003899559.1.84641 WP_003899559.1.84666 WP_003899559.1.84670 WP_003899559.1.84739 WP_003899559.1.84766 WP_003899559.1.84774 WP_003899559.1.84812 WP_003899559.1.84839 WP_003899559.1.84846 WP_003899559.1.84873 WP_003899559.1.84911 WP_003899559.1.84938 WP_003899559.1.84968 WP_003899559.1.84973 WP_003899559.1.85038 WP_003899559.1.85041 WP_003899559.1.8505 WP_003899559.1.85074 WP_003899559.1.8509 WP_003899559.1.8512 WP_003899559.1.85148 WP_003899559.1.8518 WP_003899559.1.8522 WP_003899559.1.85242 WP_003899559.1.85276 WP_003899559.1.85281 WP_003899559.1.85314 WP_003899559.1.85330 WP_003899559.1.85346 WP_003899559.1.8535 WP_003899559.1.85363 WP_003899559.1.85371 WP_003899559.1.85377 WP_003899559.1.85387 WP_003899559.1.85458 WP_003899559.1.85464 WP_003899559.1.85495 WP_003899559.1.85557 WP_003899559.1.85597 WP_003899559.1.85599 WP_003899559.1.85610 WP_003899559.1.8563 WP_003899559.1.85679 WP_003899559.1.85727 WP_003899559.1.85737 WP_003899559.1.85819 WP_003899559.1.85820 WP_003899559.1.85823 WP_003899559.1.85872 WP_003899559.1.85894 WP_003899559.1.86024 WP_003899559.1.86067 WP_003899559.1.86103 WP_003899559.1.86160 WP_003899559.1.86164 WP_003899559.1.86168 WP_003899559.1.86190 WP_003899559.1.86204 WP_003899559.1.86208 WP_003899559.1.86260 WP_003899559.1.86290 WP_003899559.1.863 WP_003899559.1.86327 WP_003899559.1.86334 WP_003899559.1.86337 WP_003899559.1.86377 WP_003899559.1.86425 WP_003899559.1.86459 WP_003899559.1.8649 WP_003899559.1.86520 WP_003899559.1.86568 WP_003899559.1.86575 WP_003899559.1.86584 WP_003899559.1.86605 WP_003899559.1.86626 WP_003899559.1.86648 WP_003899559.1.8666 WP_003899559.1.86684 WP_003899559.1.86696 WP_003899559.1.86705 WP_003899559.1.86725 WP_003899559.1.86757 WP_003899559.1.86766 WP_003899559.1.86814 WP_003899559.1.86825 WP_003899559.1.86834 WP_003899559.1.86877 WP_003899559.1.86883 WP_003899559.1.8689 WP_003899559.1.86950 WP_003899559.1.86962 WP_003899559.1.87001 WP_003899559.1.87031 WP_003899559.1.87117 WP_003899559.1.87178 WP_003899559.1.87191 WP_003899559.1.87201 WP_003899559.1.87209 WP_003899559.1.87266 WP_003899559.1.87273 WP_003899559.1.8733 WP_003899559.1.87345 WP_003899559.1.87369 WP_003899559.1.8737 WP_003899559.1.87404 WP_003899559.1.87406 WP_003899559.1.87444 WP_003899559.1.87446 WP_003899559.1.87472 WP_003899559.1.87489 WP_003899559.1.87496 WP_003899559.1.87582 WP_003899559.1.87588 WP_003899559.1.87619 WP_003899559.1.87620 WP_003899559.1.87643 WP_003899559.1.8765 WP_003899559.1.87650 WP_003899559.1.87654 WP_003899559.1.87665 WP_003899559.1.87676 WP_003899559.1.87677 WP_003899559.1.87692 WP_003899559.1.87784 WP_003899559.1.87796 WP_003899559.1.87817 WP_003899559.1.87837 WP_003899559.1.87911 WP_003899559.1.87924 WP_003899559.1.87951 WP_003899559.1.87955 WP_003899559.1.87956 WP_003899559.1.87991 WP_003899559.1.88 WP_003899559.1.88002 WP_003899559.1.88037 WP_003899559.1.88072 WP_003899559.1.88077 WP_003899559.1.88121 WP_003899559.1.88180 WP_003899559.1.88217 WP_003899559.1.88245 WP_003899559.1.88253 WP_003899559.1.88294 WP_003899559.1.88316 WP_003899559.1.88320 WP_003899559.1.88338 WP_003899559.1.88437 WP_003899559.1.88453 WP_003899559.1.88469 WP_003899559.1.88507 WP_003899559.1.88521 WP_003899559.1.88530 WP_003899559.1.88541 WP_003899559.1.88618 WP_003899559.1.8862 WP_003899559.1.88632 WP_003899559.1.88634 WP_003899559.1.88649 WP_003899559.1.88824 WP_003899559.1.88985 WP_003899559.1.8902 WP_003899559.1.89025 WP_003899559.1.89041 WP_003899559.1.89046 WP_003899559.1.89082 WP_003899559.1.89168 WP_003899559.1.89193 WP_003899559.1.89205 WP_003899559.1.89207 WP_003899559.1.8925 WP_003899559.1.89277 WP_003899559.1.89286 WP_003899559.1.89320 WP_003899559.1.89371 WP_003899559.1.89378 WP_003899559.1.89392 WP_003899559.1.89406 WP_003899559.1.8943 WP_003899559.1.89451 WP_003899559.1.89453 WP_003899559.1.89473 WP_003899559.1.89475 WP_003899559.1.89483 WP_003899559.1.895 WP_003899559.1.89513 WP_003899559.1.89517 WP_003899559.1.89522 WP_003899559.1.8954 WP_003899559.1.89543 WP_003899559.1.89567 WP_003899559.1.8957 WP_003899559.1.89572 WP_003899559.1.89589 WP_003899559.1.89607 WP_003899559.1.89625 WP_003899559.1.89648 WP_003899559.1.8967 WP_003899559.1.89670 WP_003899559.1.89676 WP_003899559.1.89729 WP_003899559.1.89739 WP_003899559.1.8977 WP_003899559.1.89802 WP_003899559.1.89808 WP_003899559.1.89844 WP_003899559.1.89849 WP_003899559.1.89901 WP_003899559.1.89903 WP_003899559.1.89909 WP_003899559.1.89926 WP_003899559.1.89971 WP_003899559.1.89987 WP_003899559.1.900 WP_003899559.1.90080 WP_003899559.1.90134 WP_003899559.1.90199 WP_003899559.1.90245 WP_003899559.1.90308 WP_003899559.1.90322 WP_003899559.1.90328 WP_003899559.1.90439 WP_003899559.1.90481 WP_003899559.1.90527 WP_003899559.1.90550 WP_003899559.1.90560 WP_003899559.1.90640 WP_003899559.1.90672 WP_003899559.1.90691 WP_003899559.1.90711 WP_003899559.1.90744 WP_003899559.1.9075 WP_003899559.1.90756 WP_003899559.1.90785 WP_003899559.1.90788 WP_003899559.1.90800 WP_003899559.1.90810 WP_003899559.1.90819 WP_003899559.1.9082 WP_003899559.1.90884 WP_003899559.1.90906 WP_003899559.1.90958 WP_003899559.1.90976 WP_003899559.1.90977 WP_003899559.1.90987 WP_003899559.1.91026 WP_003899559.1.91043 WP_003899559.1.91082 WP_003899559.1.91106 WP_003899559.1.91112 WP_003899559.1.91144 WP_003899559.1.91157 WP_003899559.1.91167 WP_003899559.1.91169 WP_003899559.1.91192 WP_003899559.1.91201 WP_003899559.1.91207 WP_003899559.1.91208 WP_003899559.1.91211 WP_003899559.1.91230 WP_003899559.1.91244 WP_003899559.1.91260 WP_003899559.1.91265 WP_003899559.1.9128 WP_003899559.1.91284 WP_003899559.1.91294 WP_003899559.1.91303 WP_003899559.1.91352 WP_003899559.1.91386 WP_003899559.1.9139 WP_003899559.1.91398 WP_003899559.1.91411 WP_003899559.1.91430 WP_003899559.1.91436 WP_003899559.1.91483 WP_003899559.1.91496 WP_003899559.1.91508 WP_003899559.1.91576 WP_003899559.1.91589 WP_003899559.1.91695 WP_003899559.1.91713 WP_003899559.1.91717 WP_003899559.1.91728 WP_003899559.1.91759 WP_003899559.1.91786 WP_003899559.1.91802 WP_003899559.1.91822 WP_003899559.1.91828 WP_003899559.1.9189 WP_003899559.1.9190 WP_003899559.1.91915 WP_003899559.1.91944 WP_003899559.1.91953 WP_003899559.1.91957 WP_003899559.1.91978 WP_003899559.1.92021 WP_003899559.1.92190 WP_003899559.1.92192 WP_003899559.1.92200 WP_003899559.1.92222 WP_003899559.1.92273 WP_003899559.1.92289 WP_003899559.1.9229 WP_003899559.1.92294 WP_003899559.1.92300 WP_003899559.1.92317 WP_003899559.1.92334 WP_003899559.1.92338 WP_003899559.1.92345 WP_003899559.1.92380 WP_003899559.1.92416 WP_003899559.1.92456 WP_003899559.1.92508 WP_003899559.1.92511 WP_003899559.1.92536 WP_003899559.1.92592 WP_003899559.1.92603 WP_003899559.1.92606 WP_003899559.1.9263 WP_003899559.1.92650 WP_003899559.1.92685 WP_003899559.1.92690 WP_003899559.1.92706 WP_003899559.1.92714 WP_003899559.1.92760 WP_003899559.1.92777 WP_003899559.1.92833 WP_003899559.1.92881 WP_003899559.1.92892 WP_003899559.1.92908 WP_003899559.1.9291 WP_003899559.1.92917 WP_003899559.1.93006 WP_003899559.1.93008 WP_003899559.1.93009 WP_003899559.1.9307 WP_003899559.1.93083 WP_003899559.1.93097 WP_003899559.1.93192 WP_003899559.1.93199 WP_003899559.1.93203 WP_003899559.1.93212 WP_003899559.1.93234 WP_003899559.1.93245 WP_003899559.1.93265 WP_003899559.1.93297 WP_003899559.1.93320 WP_003899559.1.93328 WP_003899559.1.93363 WP_003899559.1.93417 WP_003899559.1.93426 WP_003899559.1.9344 WP_003899559.1.93447 WP_003899559.1.93470 WP_003899559.1.93483 WP_003899559.1.93487 WP_003899559.1.93495 WP_003899559.1.93516 WP_003899559.1.93536 WP_003899559.1.93555 WP_003899559.1.93560 WP_003899559.1.9357 WP_003899559.1.93573 WP_003899559.1.93576 WP_003899559.1.93588 WP_003899559.1.93645 WP_003899559.1.93649 WP_003899559.1.93677 WP_003899559.1.9368 WP_003899559.1.93698 WP_003899559.1.93706 WP_003899559.1.9371 WP_003899559.1.93792 WP_003899559.1.93871 WP_003899559.1.9388 WP_003899559.1.93913 WP_003899559.1.93946 WP_003899559.1.93950 WP_003899559.1.93953 WP_003899559.1.93954 WP_003899559.1.93988 WP_003899559.1.9407 WP_003899559.1.94143 WP_003899559.1.94154 WP_003899559.1.94184 WP_003899559.1.94204 WP_003899559.1.94256 WP_003899559.1.94261 WP_003899559.1.94281 WP_003899559.1.9431 WP_003899559.1.94339 WP_003899559.1.94392 WP_003899559.1.94416 WP_003899559.1.94456 WP_003899559.1.94480 WP_003899559.1.94495 WP_003899559.1.94512 WP_003899559.1.94525 WP_003899559.1.94528 WP_003899559.1.94564 WP_003899559.1.94602 WP_003899559.1.94623 WP_003899559.1.94714 WP_003899559.1.94730 WP_003899559.1.9478 WP_003899559.1.94834 WP_003899559.1.94872 WP_003899559.1.9488 WP_003899559.1.94902 WP_003899559.1.94916 WP_003899559.1.94996 WP_003899559.1.94998 WP_003899559.1.95007 WP_003899559.1.95068 WP_003899559.1.95081 WP_003899559.1.95082 WP_003899559.1.95096 WP_003899559.1.95112 WP_003899559.1.95138 WP_003899559.1.95188 WP_003899559.1.95234 WP_003899559.1.95241 WP_003899559.1.95245 WP_003899559.1.95257 WP_003899559.1.95279 WP_003899559.1.9531 WP_003899559.1.95335 WP_003899559.1.9535 WP_003899559.1.95370 WP_003899559.1.95392 WP_003899559.1.95416 WP_003899559.1.95417 WP_003899559.1.95491 WP_003899559.1.95508 WP_003899559.1.95509 WP_003899559.1.95529 WP_003899559.1.95556 WP_003899559.1.95557 WP_003899559.1.95565 WP_003899559.1.95578 WP_003899559.1.95580 WP_003899559.1.95585 WP_003899559.1.95643 WP_003899559.1.95685 WP_003899559.1.957 WP_003899559.1.95724 WP_003899559.1.95730 WP_003899559.1.95735 WP_003899559.1.95772 WP_003899559.1.95797 WP_003899559.1.95839 WP_003899559.1.9585 WP_003899559.1.95902 WP_003899559.1.95908 WP_003899559.1.95924 WP_003899559.1.95926 WP_003899559.1.95953 WP_003899559.1.95958 WP_003899559.1.95964 WP_003899559.1.9602 WP_003899559.1.96036 WP_003899559.1.96065 WP_003899559.1.96098 WP_003899559.1.96166 WP_003899559.1.96171 WP_003899559.1.96204 WP_003899559.1.96230 WP_003899559.1.96235 WP_003899559.1.96242 WP_003899559.1.96245 WP_003899559.1.96254 WP_003899559.1.96259 WP_003899559.1.96313 WP_003899559.1.96318 WP_003899559.1.96345 WP_003899559.1.96360 WP_003899559.1.96373 WP_003899559.1.96575 WP_003899559.1.96576 WP_003899559.1.96621 WP_003899559.1.9667 WP_003899559.1.96681 WP_003899559.1.96726 WP_003899559.1.96754 WP_003899559.1.9678 WP_003899559.1.96832 WP_003899559.1.97008 WP_003899559.1.97009 WP_003899559.1.97084 WP_003899559.1.97087 WP_003899559.1.97094 WP_003899559.1.97113 WP_003899559.1.97122 WP_003899559.1.97127 WP_003899559.1.97136 WP_003899559.1.97223 WP_003899559.1.97237 WP_003899559.1.97242 WP_003899559.1.97270 WP_003899559.1.97283 WP_003899559.1.97296 WP_003899559.1.97321 WP_003899559.1.97330 WP_003899559.1.97376 WP_003899559.1.97380 WP_003899559.1.9739 WP_003899559.1.97462 WP_003899559.1.97517 WP_003899559.1.97519 WP_003899559.1.97535 WP_003899559.1.97546 WP_003899559.1.97568 WP_003899559.1.97591 WP_003899559.1.97596 WP_003899559.1.97609 WP_003899559.1.97618 WP_003899559.1.9763 WP_003899559.1.97669 WP_003899559.1.97673 WP_003899559.1.97700 WP_003899559.1.97701 WP_003899559.1.97730 WP_003899559.1.97740 WP_003899559.1.97751 WP_003899559.1.97754 WP_003899559.1.9784 WP_003899559.1.97888 WP_003899559.1.9795 WP_003899559.1.97951 WP_003899559.1.97958 WP_003899559.1.97966 WP_003899559.1.98018 WP_003899559.1.98052 WP_003899559.1.98072 WP_003899559.1.98114 WP_003899559.1.98181 WP_003899559.1.98188 WP_003899559.1.98189 WP_003899559.1.98291 WP_003899559.1.98335 WP_003899559.1.98412 WP_003899559.1.98443 WP_003899559.1.98462 WP_003899559.1.9848 WP_003899559.1.98482 WP_003899559.1.98486 WP_003899559.1.98488 WP_003899559.1.98503 WP_003899559.1.98516 WP_003899559.1.98524 WP_003899559.1.98536 WP_003899559.1.98541 WP_003899559.1.98594 WP_003899559.1.98599 WP_003899559.1.98646 WP_003899559.1.98656 WP_003899559.1.98674 WP_003899559.1.98697 WP_003899559.1.98701 WP_003899559.1.98749 WP_003899559.1.98765 WP_003899559.1.98770 WP_003899559.1.98777 WP_003899559.1.98778 WP_003899559.1.98802 WP_003899559.1.98838 WP_003899559.1.98850 WP_003899559.1.98948 WP_003899559.1.98984 WP_003899559.1.99000 WP_003899559.1.99023 WP_003899559.1.99030 WP_003899559.1.99037 WP_003899559.1.99086 WP_003899559.1.99115 WP_003899559.1.99117 WP_003899559.1.99161 WP_003899559.1.99205 WP_003899559.1.99216 WP_003899559.1.99222 WP_003899559.1.99269 WP_003899559.1.99294 WP_003899559.1.99312 WP_003899559.1.99315 WP_003899559.1.99322 WP_003899559.1.99328 WP_003899559.1.99365 WP_003899559.1.99396 WP_003899559.1.99402 WP_003899559.1.99404 WP_003899559.1.99419 WP_003899559.1.99438 WP_003899559.1.99468 WP_003899559.1.99473 WP_003899559.1.99513 WP_003899559.1.99529 WP_003899559.1.99548 WP_003899559.1.99572 WP_003899559.1.99609 WP_003899559.1.99617 WP_003899559.1.99635 WP_003899559.1.99650 WP_003899559.1.99711 WP_003899559.1.99716 WP_003899559.1.99740 WP_003899559.1.99745 WP_003899559.1.99749 WP_003899559.1.9976 WP_003899559.1.99832 WP_003899559.1.99847 WP_003899559.1.99852 WP_003899559.1.99897 WP_003899559.1.99915 WP_003899559.1.9993 WP_003899559.1.99982 WP_003899559.1.99991 gi|31794140|ref|NP_856633.1| gi|392387592|ref|YP_005309221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]