SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146311135|ref|YP_001176209.1| from Enterobacter sp. 638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146311135|ref|YP_001176209.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 1.96e-29
Family YccV-like 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146311135|ref|YP_001176209.1|
Sequence length 105
Comment hemimethylated DNA binding protein [Enterobacter sp. 638]
Sequence
MIASKYGIGQQVRHSLLGYLGVVVDIDPEYSLDEPSADELAANAELRATPWYHVVMEDDD
GQPLHTYLAEAQLSSEPQDEHPEQPSMDELAQTIRKQLQAPRLRN
Download sequence
Identical sequences A4W8X8
gi|146311135|ref|YP_001176209.1| 399742.Ent638_1478 WP_012016875.1.55209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]