SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146311866|ref|YP_001176940.1| from Enterobacter sp. 638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146311866|ref|YP_001176940.1|
Domain Number 1 Region: 227-423
Classification Level Classification E-value
Superfamily Colicin 1.96e-69
Family Colicin 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146311866|ref|YP_001176940.1|
Sequence length 427
Comment hypothetical protein Ent638_2214 [Enterobacter sp. 638]
Sequence
MSEDTINVDGKPNSNTGSNNNGHGNGTGGAGNSGSKDHGSNSGTPAQNAQVTAVFNDPVV
RKKLVALRKGALLMNPNAKVTVTGLTVDGNITVSIDGINTYQASTLGLTGLISITAKDGV
PYTSGKIPTGHKLSGSNSNSKDLPGSVLGGLIDTAVNEDNKNNAPPTLSERVNKFYHDKP
SRQGLTNLYKETLKTGKIPKAARGNLLTNLQKLLDEDKKLAAAAAQAKKDEAEVLQKTSE
IIAGTGEKISDHASAQFKTFANKIAADLKSFQGKKIRNFNDATASLNKIASNPGLKMSSA
DKSAIINALKHANAQTMAANLGNLSKVFKGADKAMMAGKVLDKTRVGFETGNWGPLILEI
ESWALSTLATAVGLGVVAYTAPFIAATVGLPVSAIAVVGIITVGIIASLIDENVATAINN
ELIKSAH
Download sequence
Identical sequences A4WB09
gi|146311866|ref|YP_001176940.1| 399742.Ent638_2214 WP_012017604.1.55209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]