SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146313174|ref|YP_001178248.1| from Enterobacter sp. 638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146313174|ref|YP_001178248.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.18e-108
Family FMN-linked oxidoreductases 0.0000000000531
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.82e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000102
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146313174|ref|YP_001178248.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Enterobacter sp. 638]
Sequence
MSRYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGG
VAPALSGVGMEGGAVLNDVSQLPHHRVVTDAVHKEGGKIALQILHTGRYSYQPHLVAPSA
IQAPINRFKPHALTHDEILTLIDEFARCAALAREAGYDGVEIMGSEGYLINEFLAARTNQ
RDDEWGGEYARRMRFAIEVVRAVRERVGTDFIIVFRLSMIDLVEGGGTFDETVQLAQAIE
AAGATIINTGIGWHEARIPTIATAVPRAAFSWVTRKLKGKVSIPLVTTNRINDPQVADDV
LANGDADMVSMARPFLADAELLSKAQSDRADEINTCIGCNQACLDQIFVGKVTSCLVNPR
ACHETKMPIVPAVKIKRLAVVGAGPAGLAFAVNAASRGHAVTLFDAAAEIGGQFNIAKQI
PGKEEFYETLRYYRKMIALTGVDLRLNHFVTAPDLTEFDEVILASGIAPRMPEIEGIDHP
NVLSYLDVLRDKVPVGEKVAIIGCGGIGFDTAMYLSQPGEATSQNIAEFCVEWGIDTSLN
QSGGLRPEGPQLPKSPRQIVMLQRKASKPGEGLGKTTGWIHRTTLLSRGVKMIPAVSYQK
IDDDGLHVSIGGEPQLLRVDQVILCAGQEPRRELADPLREAGITVHLIGGCDVAMELDAR
RAIAQGTKLALTI
Download sequence
Identical sequences A4WER7
399742.Ent638_3539 WP_015960523.1.55209 gi|146313174|ref|YP_001178248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]