SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|566719415|ref|YP_008919737.1| from Alteromonas macleodii str. 'Aegean Sea MED64'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566719415|ref|YP_008919737.1|
Domain Number 1 Region: 11-371
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.15e-108
Family FMN-linked oxidoreductases 0.00000000408
Further Details:      
 
Domain Number 2 Region: 342-528
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000145
Further Details:      
 
Domain Number 3 Region: 479-635
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|566719415|ref|YP_008919737.1|
Sequence length 680
Comment 2,4-dienoyl-CoA reductase [Alteromonas macleodii str. 'Aegean Sea MED64']
Sequence
MSTPSPQPSPFYPNLLAPLDLGFTTLKNRTLMGSMHLGLEEEKGGFDKLAAFYAERAKGG
AGLIVTGGISPNISGWVAPFAGRMTRSRHAKKHRVITDAVHQEDGKICMQILHSGRYGYH
PLAVSASPMKSPITPFKPRELSSRGVRGTIKDYIKCASLAQKAGYDGVEIMGSEGYLINQ
FFCKRTNHRNDEWGGSLENRARLALEIVKGVREKVGTNFIIIYRLSMLDLVEGGAKWDEV
VYLAKEIEKAGATLINTGIGWHEARVPTISTSVPRAAFTWITQRMKKEVSIPLVTTNRIN
TPEVAESVLAEGHADMVSMARPFLADAHFVAKAMRNESKLINTCIACNQACLDHAFEQKR
ASCLVNPQACYETELTFTPTQAKKKLAVVGAGPAGLAFSMYAADRGHEVHLFDKASEIGG
QFNYAKQVPGKEEFYETLRYFDNQLARVGVTIHLNHEVNAESLLNMGFDEVVLATGINPR
KLTIEGHNHRKVMSYLDVLRDHKPVGKKVAIIGAGGIGFDVAEFLVEHEHLAQDKEKWLD
HWGIDKGYSAPGALKEKAIEPSEREVYLLQRKTSKVGKGLGKTTGWIHRQSLKHHNVQMI
NGVSYEKVDDEGLHVLINDAPKVLPVDNIIVCAGQEPFKPLQQPLEEAGVSVHIIGGADV
AAELDAKRAIRQGAELAARI
Download sequence
Identical sequences WP_024016797.1.48123 gi|566719415|ref|YP_008919737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]